KEGG   Cricetulus griseus (Chinese hamster): 100759423
Entry
100759423         CDS       T02813                                 
Symbol
Rimkla
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X2
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00250  Alanine, aspartate and glutamate metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100759423 (Rimkla)
Enzymes [BR:cge01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100759423 (Rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100759423 (Rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 100759423
NCBI-ProteinID: XP_027254918
LinkDB
Position
2:32689219..32710772
AA seq 380 aa
MCAQVWLLTDRLIREDYPQVQILRALRQRCSEQDVRFRAVFLDQIAVTVVGGHLGLQLSQ
KPLTTFPDVVVVRLSTPSVQSDSEITILRHLEKLGCRLINRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLV
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCFLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGAIIADYAM
SLLPNRQTGKTAILPGLSSPREKNEPSGCASAQVVENVYAINNGSTSSESEPELAEVRDS
SAKTMVGIPPPQVARTWLQH
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtgcgcgcaggtctggctgctgaccgaccgactcatccgcgaggactacccgcaagtg
cagatcctgcgcgcgctccgccagcgctgctcggagcaggacgtgcgcttccgggctgtg
ttcctggaccagatcgctgtcactgtcgtcggcggccacttaggcctgcagctgagccag
aaacccctgactacattccccgatgtggtggttgtacgactgtccactccctctgtccag
tcagatagtgaaatcaccatcctgaggcacctggagaagctgggctgccgcttgatcaac
cgtcctcaaagcatcttaaactgtatcaacaagttttggacattccaagagctggctgga
catggggtccccatgccagacaccttctcctatggtgggcatgaagacttttctaaaatg
attgatgaagcagagcccctgggctacccagtggtggtgaagagcacacggggacaccgg
ggaaaagctgttttcctggctagagacaagcatcacctctctgacatctgccacctggtc
cgccatgacgtgccctacctgttccagaagtatgtgaaggagtcacatgggaaggacatc
cgggtggtggtggtgggtggccaggtgatcggctccatgctgcgatgctccacagatggc
cgcatgcaaagcaactgcttcctaggtggtgtgggcgtcaagtgtccactgacagagcaa
ggcaagcagctggctatccaggtatccaacatcctgggcatggatttctgtggtattgac
cttctcatcatggatgatggctccttcgtggtgtgtgaggcaaacgccaatgtcggcttc
ctagccttcgaccaggcatgcaacttagatgtgggggcaatcattgcagactatgccatg
tccttactgcccaacaggcagacggggaagacggccatcctcccgggactgtcaagtccc
agggaaaagaatgagccaagtggttgtgcttcagctcaggtggttgagaatgtctatgcc
atcaacaatgggtctacctctagtgagagtgagcctgaactggcagaggtccgggattcc
tcagcaaaaacgatggtggggatcccacctccccaagttgcccgaacctggttacaacat
taa

DBGET integrated database retrieval system