KEGG   Cricetulus griseus (Chinese hamster): 100762705
Entry
100762705         CDS       T02813                                 
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X3
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100762705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cge04050]
    100762705
   04090 CD molecules [BR:cge04090]
    100762705
Cytokine receptors [BR:cge04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100762705
CD molecules [BR:cge04090]
 Proteins
  100762705
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100762705
NCBI-ProteinID: XP_027253944
LinkDB
Position
2:8629591..8680249
AA seq 496 aa
MSALRAALGLLLLGMLRAFPKDRPLKTTCAGDPNYYAGSCCHRCPPGLSPTQPCPQGPDH
CRKQCDPDHYVNEDGHCTACVTCLEGLVEKAPCSMNSSRVCECQPGTYCKTPGVNSCARC
SLHSRCSGGEVVKVPGTAEKDTVCELPSSGPGPDCSNPDDCKTLTSHATPQATPTLKTSA
TDSMRSLTTTGSTGLVQEDATELLKVPEFPSSQAREPSPDPDKAEMNMNLKLPSPGTLPD
FSTSGNSEEPASTASTLSLLVDVQTSSRMQPTSPLSTGTPFLDPGPMLFWVAMVILLLGS
STFFLCYWKACRRRIQQKLHLENLAQTFQPKMEQVDFRPAKKPTQLKRSVSATDPSTGHK
LSPVSPPVVETCTNVGAACLESQPLLDDSTAGNPLTPREPPEPRVSTTEHTNNRIEKIYI
MKADTVIVGSVKTEVPEGRAPAGSTEPEWEAELEVDHTPHYPEQETEPPLGSCTEVMFSV
EEGGKEDHEPTTVSEK
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgagcgccctccgcgcggccttgggattgctgctcctggggatgcttcgagccttccca
aaggatcgaccactcaagaccacctgtgccggagaccccaattactatgctgggagctgc
tgtcaccgttgccccccagggttgtctccaacacagccgtgcccacagggtcctgaccac
tgcaggaagcaatgtgatcccgaccactacgtgaacgaagatgggcactgcacagcctgc
gtgacctgtttggaaggtcttgtggagaaggctccatgttccatgaactcttctcgagtc
tgtgagtgtcaacctggcacttactgcaaaacgccaggtgtcaattcttgtgcccgctgt
tctctacactcccgctgttctggaggcgaggtcgtcaaggtcccaggcacagcagagaag
gacaccgtctgtgaactgccttcctcaggacctggccctgattgctccaatccagatgac
tgcaagacacttactagccatgccactcctcaggccacacctactttgaagacctcagcc
actgacagtatgaggagcttgacaacgacagggagcaccggccttgtgcaggaagatgct
actgagctgttgaaggtcccagagtttccctcttcccaggcaagggagcccagtccagac
ccagataaggcagagatgaatatgaacttgaaactgccatctccagggactcttcctgac
ttcagcacctcaggaaacagtgaggagcctgccagtaccgcctccaccctgagcctcctg
gtagatgtgcagaccagcagcaggatgcagcccacctctcccttgtccacaggaacacca
tttctggatccagggcccatgctcttctgggtggccatggtgattctgctgcttggctcc
agcaccttcttcctgtgttactggaaggcctgcaggaggcggatccagcagaagctccac
ctggaaaacctagcccagaccttccagccgaagatggagcaggtggatttcagacctgcc
aaaaaaccaactcagctgaagagaagtgtgtcagcgacagatcccagcacaggacacaag
ctgagcccggtgagccctccagttgtggagacttgtaccaatgttggggcagcatgcctg
gagagccaaccactgttggatgacagcacagccgggaatcctttgacccccagggaacct
ccagagccccgggtatccaccacagaacacactaataatagaattgagaaaatctacatc
atgaaggctgacacagtgattgtgggctctgtaaagaccgaagtccctgagggccgggct
ccagcagggtctacggagcctgagtgggaagctgaattggaagtggatcacacccctcac
taccctgagcaggagacagagccacctctgggcagctgcactgaggtcatgttctcagtg
gaggaaggaggaaaagaggaccacgagcccacgactgtctctgagaagtga

DBGET integrated database retrieval system