KEGG   Cytobacillus gottheilii: J1899_07475
Entry
J1899_07475       CDS       T07465                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
cgot  Cytobacillus gottheilii
Brite
KEGG Orthology (KO) [BR:cgot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cgot03000]
    J1899_07475
Transcription factors [BR:cgot03000]
 Prokaryotic type
  Other transcription factors
   Others
    J1899_07475
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: QVY62877
UniProt: A0A8E7PPR4
LinkDB
Position
1521785..1522753
AA seq 322 aa
MHLLFKKFGFLLLCLIFLSSCGQAMSPGTLQKAGLLVPDTVNDQVWGTKGYKGMLKIQSH
YNIEVYYKEGMNSAAIVQRAVEEFDQKGVNLIFGHGNEYAEYFNDFSEDYPHIQFVSFNG
DAKNKNTTSLGFEGYAMGFFGGMVAGHMTKTNTVGVLAAFEWQPEIKGFAEGAKFQNKDV
NVKIEYVGGWDDHETANIMLGKLNNTGADVIYPAGDGYNVPIIEKIKENGQYAIGYISDQ
SDLGESTVLTSTIQHVDVLYELVADKFNNGELPSGNLSFDFQDDVISLGKFSPVVDQVFK
EEMNQAINQYKSTGKLPNNEQQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcatcttttattcaagaaattcgggttccttcttttgtgccttatttttttatcttca
tgcggacaggctatgtcgccaggaacattgcagaaggctggtttattagtgcctgacaca
gtgaacgatcaagtatggggaacaaaaggctataaaggaatgctaaagattcaatctcat
tataatattgaggtttattataaagaggggatgaactctgcagcgatcgtccagcgtgca
gtagaggaatttgatcaaaaaggtgtcaaccttatttttgggcatggaaatgagtatgct
gaatattttaatgatttttccgaagactatcctcatatacagtttgtcagctttaatggt
gatgcaaaaaacaagaatacgacaagcctaggatttgaaggatacgcaatggggtttttc
ggtggaatggtcgcgggtcatatgacaaaaacaaatacggttggcgtgttggcggctttt
gaatggcagcctgaaataaagggatttgctgaaggcgcaaaattccaaaataaagatgtt
aatgttaaaatagaatacgtcggaggctgggacgatcatgaaacagccaatatcatgctg
gggaagctaaataatacaggtgcggatgttatttaccctgctggagatggctacaatgtc
ccgataatcgaaaaaataaaagaaaacgggcaatatgcgatcggttatatctcggatcag
agtgatcttggggaatcaacggtgttaacaagtaccattcagcatgtcgatgtcttatat
gagcttgttgctgataagtttaacaatggagagctgccatcagggaatttatcttttgat
tttcaagatgatgtcatttcattaggtaagtttagtccagtggtggatcaagtttttaaa
gaagaaatgaaccaagcaatcaatcagtataaaagcacaggaaagctgccaaataatgag
cagcagtaa

DBGET integrated database retrieval system