KEGG   Candida glabrata: CAGL0G09196g
Entry
CAGL0G09196g      CDS       T01024                                 
Name
(RefSeq) uncharacterized protein
  KO
K06663  DNA damage checkpoint protein
Organism
cgr  Candida glabrata
Pathway
cgr04111  Cell cycle - yeast
cgr04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CAGL0G09196g
   04113 Meiosis - yeast
    CAGL0G09196g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cgr03400]
    CAGL0G09196g
DNA repair and recombination proteins [BR:cgr03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    CAGL0G09196g
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 2888046
NCBI-ProteinID: XP_446761
UniProt: Q6FSN3 A0A0W0C9D7
LinkDB
Position
G:878291..880024
AA seq 577 aa
MSISLKVKAFDVSIRDTERQTLWFRAVYYLSTISEEICLTISDSFIIASAVNSAYTSSCK
VTFERKFFDSFEYNPHEIVFGESGLQVAKDAIGESKKLYSLLINGKHLTTISKVSSDSGP
VNEFKIAIDNTISCPEALANRLLVSIEMESLVQKEYSPQFTPTQYNPILVDLKYKRKFLD
VFGTTETRSTSNSPIDPKLREICRNIEQELSKELFTDAITSENRDRNAMMEEINYICCNQ
SLLRNFVDNCNTSLTDEIQLQLDTRRLILTAFTKAIYGKGNDILKSAISMSNTIALTTLE
HCSIFWVEDKEMSGRKPMAKTIVFKSKEFKNFVAMNTSSRQHDYSTGCINIWFCNPGDPI
LMEHKKGNVKFELLQVTDSYSQDNLPKVIAEGINTNSESPNKYSVSPLRMSAIKSTSNMN
IKKEPRNTPLSKVYNMSSGYKDMSDGKPSPTRRLFVADDDMSEGELQSENQSVIERNSKE
TAFNVIPVHGFSNSHLDKDVGIALNERTEATRNATIIGWGSNTDMSEVTTNNANSGIDLF
KKEKRKIYEQEGSQSKKAKGESQFGPTQTELPKGLLD
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtctataagtttgaaagttaaggcatttgatgtctcaatacgcgatactgaaaggcaa
acgctgtggtttcgtgccgtatactatctgtcaaccattagtgaagagatctgtttaact
atttctgactcattcataattgcctcggctgttaacagtgcgtatacaagctcatgtaag
gtaacctttgagagaaagttttttgatagttttgaatataatccacatgaaattgtcttt
ggagaatcaggtttacaggtagctaaagatgccatcggtgagtccaagaaactatactcg
ttgttgatcaacggaaagcatttgacgactatatccaaggtctcttcagacagcggaccg
gtgaatgaatttaagattgcaattgataatactatatcatgtccggaagcattggcaaac
cgtcttttggtttctatcgaaatggagtcattggttcagaaggaatatagtccacagttt
acgccaacacagtataacccgattttagttgatttaaaatataaaagaaaatttctagat
gtattcggaaccacagagacgcggtctacatctaattctcccattgatcctaagcttcgg
gagatttgtaggaatatagaacaagagttatcaaaagagttattcacagatgctataaca
agtgaaaatcgtgaccgtaatgcaatgatggaagaaataaactacatttgttgtaatcaa
tctttactaagaaattttgttgataattgtaacacatcgctaactgatgagatccaactt
caactagatacgcgaagactgatcctaacggctttcacaaaagccatatatgggaagggc
aatgatatactgaaaagtgctatatcaatgagtaatactattgccctcactacacttgaa
cattgttcaatattttgggttgaggataaggagatgtcaggcagaaaacctatggccaag
acgattgtattcaagtctaaagagttcaagaattttgttgcgatgaatacatcctcaaga
cagcacgattattcgacagggtgtatcaatatatggttttgtaatcccggcgatccaatt
ctgatggaacataagaaaggtaatgttaaatttgaactgcttcaggtaacggactcgtat
tcacaagataatttacctaaggtcattgcagaaggcattaacactaacagtgaatctcca
aacaagtactcggtttcacccttgcgaatgagtgccataaagtcaacttctaatatgaat
atcaagaaggaaccacgaaacactcctttaagtaaagtttataacatgtcttccggttat
aaggacatgtctgatgggaagccaagtcctaccaggaggttatttgttgctgatgatgat
atgtcagaaggagagcttcaatcagagaaccaatctgtaattgaaagaaacagcaaagaa
acagctttcaatgtcattccagttcacggtttctcaaacagtcaccttgataaggatgtt
gggattgcgttaaatgagagaacagaagctaccagaaatgcaacaataattggatggggc
tcgaatacagacatgtcagaggtaactacaaacaatgctaattcagggatagatttgttt
aagaaggagaaacgtaaaatatatgagcaagagggtagtcaaagtaaaaaagctaaagga
gaatcccaatttggacctacacaaacggaactacctaaaggtttactggattaa

DBGET integrated database retrieval system