KEGG   Candida glabrata: CAGL0I01474g
Entry
CAGL0I01474g      CDS       T01024                                 
Name
(RefSeq) uncharacterized protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
cgr  Candida glabrata
Pathway
cgr04111  Cell cycle - yeast
cgr04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CAGL0I01474g
   04113 Meiosis - yeast
    CAGL0I01474g
SSDB
Motif
Pfam: CDT1 CDT1_C Calsequestrin
Other DBs
NCBI-GeneID: 2888958
NCBI-ProteinID: XP_447318
UniProt: Q6FR26
LinkDB
Position
I:complement(117899..119680)
AA seq 593 aa
MVSLRVGGGLTMDRVPVIDLDEVSDDVALQKVLRSILLGHDTFLLKNYANREKLDLELSQ
LSPIDVSQGFDSNFTGALQLEDDVVLEQYIATTDAAFKFAREAKDPMLRKVSSRLLKVLM
YFSQLCLRSLDINGVTLDDSHHSTKLVRYYHPTEVEKAVLPDGSDLEFEYEASEFNTVRT
PGILSVIPVARNVRVKPSTMSNDENVWITIDEPDCLLLHTGELLAKESRHMHSTSPLQIN
MKKNVVQLTLLPALGYKSPDANTTLAQDFLEEQILEFKKVSQVYYPREFSILQLKEKISF
VKALFNVAETVVSLHQMSRASNRDPLLHDLLPQISNMMNRKVSSNDFLKIVTVWPQAYKV
DYNSNGELMVNLPKKDPLAMLTNNSRKLDFVKKLEEWYENVTKSQEIPDDIPVYKIGKRR
GSDGQGSISIANTNIKLANTRPIASPAKYISNPKEKFQNLERPHDSQENLLERLRERERR
SAALLSQRKHNYEQFLTVKMKQVFEIMYSLRPNEPYTATYLATLTVDSLQNSNNPVGYEE
ATDILDRLERLLGDILIVHTVDGGLKVYRWELLDRDQFMELLDKYKKHNTTNM
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggtctctctcagggttggtgggggtttaaccatggatagagtgcctgtgattgatctg
gatgaagtgtctgacgacgtggcgttgcaaaaagtgctgaggagcatactgttgggccac
gatacgttcttgctgaagaactatgcgaaccgggagaagctcgacttggagcttagccag
ctctcgccgattgatgtctcgcaagggtttgactcgaacttcaccggtgcgctgcagttg
gaagacgacgtggtcctggaacagtacatcgctaccacggacgctgcgttcaagtttgcg
agggaggcgaaggacccgatgttgaggaaagtgagctctaggctgctgaaagtgttgatg
tacttctcacagctgtgtctaaggagtcttgatatcaacggagttacattggatgattcc
catcactcgacaaagctggttcgttactaccacccaactgaagttgagaaagcagtgtta
cctgacgggtctgacttggagtttgagtacgaagcatcagagttcaacactgtgagaaca
ccagggatcttgtctgtcatacccgtggctagaaatgtacgagtgaaaccatccactatg
agcaacgatgaaaacgtatggatcactatagatgaacccgattgtcttctgttgcatacc
ggcgagctattggcaaaggagtctcgccacatgcactccacatcgccactacagattaat
atgaagaagaacgtcgtccaattgactttgcttcctgctttgggttacaaatcaccagat
gctaacaccacgttggctcaagatttccttgaagaacagatactggagtttaaaaaagtg
tcacaagtctactatcctcgcgaattttctatactgcaattgaaagagaagataagtttc
gtgaaagcattgttcaatgttgctgaaacagttgtttcattacaccagatgtctagagct
agtaatagagatccattgctacatgatctacttccacaaatatccaatatgatgaatagg
aaagtgtctagcaatgacttcttaaaaatagtgactgtatggccacaagcgtataaggtg
gattacaactctaatggtgaactcatggtgaatctaccaaaaaaggaccccttggcgatg
ctaactaacaactccagaaaacttgattttgttaaaaagttggaagaatggtatgaaaac
gtaacgaaatcacaagagatcccagacgatattcctgtttataagattggtaaaagacgt
ggcagtgatgggcagggttccatttccatagcgaatacgaacatcaagttagctaataca
agacctattgcctcaccagccaaatacataagtaatccaaaagaaaaattccaaaactta
gaacgtcctcacgactcgcaggagaatttactagagagattaagagaaagagagagaaga
tctgccgcccttctatcacagagaaaacacaactacgaacaattcttaactgtaaagatg
aaacaggtgtttgagatcatgtactcattgagaccgaatgaaccttacactgcaacgtat
ttggctaccttaaccgtggatagcttgcaaaatagtaataatcccgttggatatgaagaa
gcaacagatatccttgacagacttgaacgtcttttgggggatatattgattgttcataca
gttgatggtggtctcaaagtatacagatgggaactgctcgacagagaccagtttatggaa
cttcttgacaaatacaagaaacataatactacgaatatgtaa

DBGET integrated database retrieval system