KEGG   Chitinophaga sp. MD30B: KTO58_27555
Entry
KTO58_27555       CDS       T08407                                 
Name
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
Organism
chf  Chitinophaga sp. MD30B
SSDB
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Other DBs
NCBI-ProteinID: UCJ07373
LinkDB
Position
7306225..7307460
AA seq 411 aa
MSTNVHFTKGKGIRLYTAQDEEYIDAVSGTFNIALGYSHPELVDALKTQVEDLIHVSSSF
TADLAQSVLDGILEHAPAHINDGWMRDIIGSTANEGAVKIANKYNGKNEVISLAMSHHGQ
TLFATNISGNAFRRKSFANTLSTNNAIVPAPYCYRCPFSAKGVPDCGFMCTEAIYDYVQY
GSSGNVSCIILEPILGNGGNIVPPEGYFQRIKKICEELDLVLIADEVQTGIGRTGYMFAS
EHYDIQPDIITLAKGLGGIGIPAAAILYRSELNVLEKFEHSYTSGGNLLSLTATQKTMEV
VSREGFLENVRNNGKVLGELLNKLKEHYGHIIGDVRGIGYMWGLEIIDKDGAPDVPLTNR
IIDIALDDHKMILRGSRYGFGNVVKVRPALTATLDDIEEIYSRLDKLFAKL
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtccactaacgttcacttcaccaaagggaaaggtattcgcctctacactgctcaagat
gaggaatacatcgatgccgtttccggaacattcaacattgctttgggatatagtcacccc
gagctggtagatgccctcaaaacccaagtggaagacctcatccacgtgtcgtcctcattt
actgcggacctggcgcaatccgtactggacggtatcctcgaacatgcccctgcacacatc
aacgacggctggatgcgcgatattatcggctctacagctaacgaaggtgcggtgaaaatt
gccaacaagtacaacggtaaaaatgaagtcatcagccttgctatgtcgcatcacggacag
accttgttcgcgactaacatatcaggtaatgccttccgccgtaaatcatttgccaacacg
ttatcaacgaacaacgccattgtacccgcgccttactgctatcgatgcccattctctgcc
aaaggagtacctgattgtggatttatgtgtacagaagcgatctatgactatgtacagtat
ggcagctccggtaacgtatcctgtattatcctggaacctatcttgggcaacggcgggaat
atcgttccaccggaaggctacttccaaaggatcaaaaagatctgtgaagagctggacctg
gtgctgatcgccgatgaagtacagaccgggatcggtcgtaccggctatatgtttgccagc
gaacattatgatatccagccggatattatcacactcgcgaaaggtcttggtggtatcggt
ataccagccgcggctatcctctatcgttccgaactcaatgtgctggagaagtttgaacac
tcttatacttccggtggtaacctgctgtcgctgactgctacgcagaagaccatggaagta
gtatccagagaaggtttcctggagaatgtacgtaacaacggaaaggtgctgggagagctg
ctgaacaagctaaaagagcattacggacatatcatcggtgatgtaagaggtatcggatat
atgtgggggctggagatcatcgataaggacggtgctcctgatgtgccgctcacgaaccgt
atcatcgatattgcccttgatgatcataagatgatattgagaggttcccggtatggattc
ggtaatgtcgtaaaggtaaggccggcgcttacggcaacgctcgacgacattgaagagata
tacagccgcctggataaactatttgccaaactttaa

DBGET integrated database retrieval system