Chitinibacter bivalviorum: HQ393_15295 Help Entry HQ393_15295       CDS       T06696                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism chiz  Chitinibacter bivalviorum Pathway chiz00400   Phenylalanine, tyrosine and tryptophan biosynthesis chiz01100   Metabolic pathways chiz01110   Biosynthesis of secondary metabolites chiz01230   Biosynthesis of amino acids Module chiz_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine chiz_M00025   Tyrosine biosynthesis, chorismate => HPP => tyrosine Brite KEGG Orthology (KO) [BR:chiz00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     HQ393_15295 Enzymes [BR:chiz01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      HQ393_15295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Seryl_tRNA_N LZ_Tnp_IS66 Motif Other DBs NCBI-ProteinID:  QLG89500 UniProt:  A0A7H9BLE4 LinkDB All DBs Position 3217317..3217592 Genome browser AA seq 91 aa AA seqDB search MSVPAELLALREQIDALDQQLFSVLAERFKVTAQVGQLKKQYQLPAQDVTRETQQLEKTA ARAAQAGLDPEFAQRLQRLILDEVVLQHQRC NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgccagccgaattactagctttgcgcgagcaaattgatgcgctcgatcagcag ctgtttagtgtgttggccgagcgtttcaaagtcaccgcgcaagttggacaattgaaaaag caatatcaattaccggcgcaagatgtgacgcgcgaaacgcagcagttggaaaaaacggct gctcgtgccgcccaagctgggctcgatccagaatttgcgcagcgtttgcagcgcctgatt ctggatgaagtcgtattgcagcatcagcgctgctaa

DBGET integrated database retrieval system