Corynebacterium halotolerans: A605_03410 Help Entry A605_03410        CDS       T02472                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism chn  Corynebacterium halotolerans Pathway chn00074   Mycolic acid biosynthesis chn00280   Valine, leucine and isoleucine degradation chn00630   Glyoxylate and dicarboxylate metabolism chn00640   Propanoate metabolism chn01100   Metabolic pathways chn01110   Biosynthesis of secondary metabolites chn01120   Microbial metabolism in diverse environments chn01200   Carbon metabolism Module chn_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:chn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     A605_03410    00640 Propanoate metabolism     A605_03410   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     A605_03410   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     A605_03410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon RVT_thumb Motif Other DBs NCBI-ProteinID:  AGF71693 UniProt:  M1NJW2 LinkDB All DBs Position complement(727398..727616) Genome browser AA seq 72 aa AA seqDB search MTTTTDKPLFRVLKGNPDATELAALTAVITSLAGKKPAATDSRERNMWGRPEDRLQRPAL YNPNAFRNVTYF NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgaccaccaccaccgacaagccgttgttccgcgtgctcaagggcaacccggacgccacc gagctcgccgccctcaccgcggtgatcacctccctggccggcaagaagcccgccgccacc gactcccgcgagcgcaacatgtggggacgtcccgaggaccgcctccagcgccccgcgctc tacaacccgaacgccttccgcaacgtcacctacttctga

DBGET integrated database retrieval system