KEGG   Capra hircus (goat): 102169331
Entry
102169331         CDS       T02910                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
chx  Capra hircus (goat)
Pathway
chx04927  Cortisol synthesis and secretion
chx04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102169331 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102169331 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ T4SS_pilin
Other DBs
NCBI-GeneID: 102169331
NCBI-ProteinID: XP_005674803
LinkDB
Position
1:complement(1646739..1663744)
AA seq 156 aa
MANRTNTSAPYYSYEYYLDYLDLMPVDEKKLSANKHSIAIAFWVSLAAFVVFLFLILLYM
SWSGSPQTRNATQQPPTCPWSLGLNLPLYVWRQPQHPRAPPGDPAASTELGRGTGRRSIP
ACPVAATRETLHLGAXQDHPALLWELALSGDLQGTS
NT seq 471 nt   +upstreamnt  +downstreamnt
atggccaacagaaccaacacctctgccccatactacagctacgaatactacctggactac
ttggacctcatgcccgtggatgagaagaagctaagcgccaacaaacactcgatcgccatc
gccttctgggtgagcctggcagctttcgtggtttttctcttcctcatccttctctacatg
tcctggtcaggctctccacagacgaggaacgccacccagcagcccccaacgtgtccctgg
agtcttggcctcaacctcccgctctacgtctggaggcaaccccagcaccccagggccccc
ccgggggaccctgcagcctccaccgagctcggtcgaggaaccggacgccggagcatcccg
gcctgtccagtggctgcaacgagagagaccctccacctcggcgccncccaggaccaccct
gctctcctctgggaactggccctcagtggggacctacagggcaccagctga

DBGET integrated database retrieval system