Capra hircus (goat): 102177339 Help Entry 102177339         CDS       T02910                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04020   Calcium signaling pathway chx04022   cGMP-PKG signaling pathway chx04114   Oocyte meiosis chx04218   Cellular senescence chx04310   Wnt signaling pathway chx04360   Axon guidance chx04370   VEGF signaling pathway chx04380   Osteoclast differentiation chx04625   C-type lectin receptor signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04720   Long-term potentiation chx04724   Glutamatergic synapse chx04921   Oxytocin signaling pathway chx04922   Glucagon signaling pathway chx04924   Renin secretion chx05010   Alzheimer disease chx05014   Amyotrophic lateral sclerosis chx05020   Prion disease chx05022   Pathways of neurodegeneration - multiple diseases chx05031   Amphetamine addiction chx05152   Tuberculosis chx05163   Human cytomegalovirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05170   Human immunodeficiency virus 1 infection chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102177339 (PPP3R2)    04310 Wnt signaling pathway     102177339 (PPP3R2)    04370 VEGF signaling pathway     102177339 (PPP3R2)    04020 Calcium signaling pathway     102177339 (PPP3R2)    04022 cGMP-PKG signaling pathway     102177339 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102177339 (PPP3R2)    04218 Cellular senescence     102177339 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102177339 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     102177339 (PPP3R2)    04660 T cell receptor signaling pathway     102177339 (PPP3R2)    04658 Th1 and Th2 cell differentiation     102177339 (PPP3R2)    04659 Th17 cell differentiation     102177339 (PPP3R2)    04662 B cell receptor signaling pathway     102177339 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     102177339 (PPP3R2)    04921 Oxytocin signaling pathway     102177339 (PPP3R2)    04924 Renin secretion     102177339 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     102177339 (PPP3R2)    04720 Long-term potentiation     102177339 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     102177339 (PPP3R2)    04380 Osteoclast differentiation     102177339 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102177339 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102177339 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     102177339 (PPP3R2)    05163 Human cytomegalovirus infection     102177339 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     102177339 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     102177339 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     102177339 (PPP3R2)    05014 Amyotrophic lateral sclerosis     102177339 (PPP3R2)    05020 Prion disease     102177339 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     102177339 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     102177339 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102177339 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:chx01009]     102177339 (PPP3R2) Protein phosphatases and associated proteins [BR:chx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102177339 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  102177339 NCBI-ProteinID:  XP_005684314 LinkDB All DBs Position 8:complement(91161055..91161948) Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEICSHFDEDEIKRLRKRFKKLDLDGSNALSVKEFTSIPELQKNPLVQRVID VFDTDGDGQVDFQEFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggaggagatatgctcgcactttgacgaagatgaaatt aaaaggctgcgcaagcggtttaagaagctggacttggacggttccaacgctctgagcgtc aaagagttcacgtccataccggagctgcagaagaacccgctggtgcagcgggtgatcgac gtcttcgacaccgacggcgacggacaggtggacttccaggaattcatcttggggacctcc cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg ggggacaatctgaaagattggcagttacagcagctggtggacaaaaccatcatcctcctg gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg gaggtccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system