Capra hircus (goat): 108636012 Help Entry 108636012         CDS       T02910                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism chx  Capra hircus (goat) Pathway chx04613   Neutrophil extracellular trap formation chx05034   Alcoholism chx05202   Transcriptional misregulation in cancer chx05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108636012  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     108636012   09163 Immune disease    05322 Systemic lupus erythematosus     108636012   09165 Substance dependence    05034 Alcoholism     108636012  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:chx03036]     108636012   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     108636012 Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108636012 Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108636012 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  108636012 NCBI-ProteinID:  XP_017903535 EnsemblRapid:  ENSCHIG00000007552 UniProt:  A0A452DUP8 LinkDB All DBs Position 5:complement(55410664..55411335) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKRPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacgtcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system