KEGG   Celeribacter indicus: P73_0347
Entry
P73_0347          CDS       T03575                                 

Definition
(GenBank) Biphenyl 2,3-dioxygenase subunit beta
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
cid  Celeribacter indicus
Pathway
cid00621  Dioxin degradation
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    P73_0347
Enzymes [BR:cid01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     P73_0347
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: AJE45062
UniProt: A0A0B5DXV7
LinkDB
Position
355138..355695
AA seq 185 aa
MLDDKMTDRFAVKPGLVPVELQHEVEQFYFWEAKLMTDRRYVEWFALLAKDLRYWMPLRE
TKFIREAEKEYADDHGFAHFDDTWATMDGRIRKITSDVGWSENPASRVRHIIGNVMISPE
DDNTLHTISALVTYRSRQERQVDIFACERQDVLRRTDSEAGFEIVRRKILIDQSTILSNN
LSFFF
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcttgatgacaagatgacggatcgtttcgccgtcaaaccggggctcgttcccgtcgag
ttgcagcatgaggtcgaacaattctacttttgggaagcgaagctcatgaccgatcggcgc
tatgtcgagtggttcgcgctcctggcgaaggatctccggtactggatgccgcttcgtgaa
acgaagttcatacgggaggcggagaaggaatacgccgacgatcatggttttgcgcatttc
gatgatacctgggccacgatggacggccgtatccgcaagatcacatcggacgtgggctgg
tcggaaaacccggcctcgcgcgtgcgtcacatcatcggaaacgtgatgatctcgccggag
gacgacaacacgctgcacaccatctccgccttggtcacctaccggtcccggcaggagcgt
caggtcgacatcttcgcctgcgagcgacaggacgtgctgcgccgcaccgacagcgaggcg
ggtttcgagatcgtgcggcggaagatcctcatcgaccagagcacgatcttgtcgaacaac
ctgagcttcttcttctga

DBGET integrated database retrieval system