Celeribacter indicus: P73_2250 Help Entry P73_2250          CDS       T03575                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism cid  Celeribacter indicus Pathway cid02024   Quorum sensing cid03018   RNA degradation Brite KEGG Orthology (KO) [BR:cid00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     P73_2250 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     P73_2250 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cid03019]     P73_2250 (hfq)    03036 Chromosome and associated proteins [BR:cid03036]     P73_2250 (hfq) Messenger RNA biogenesis [BR:cid03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      P73_2250 (hfq) Chromosome and associated proteins [BR:cid03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     P73_2250 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AJE46965 UniProt:  A0A0B5E0L5 LinkDB All DBs Position 2260457..2260690 Genome browser AA seq 77 aa AA seqDB search MAADKQNLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRRDGQSQLVYKHA ISTIMPAQPINLYDSEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccgccgataaacagaatctccaggatgccttcctcaatcacgtccgcaagaccaag gttcccgtcacgatcttcctgatcaacggggtgaagcttcagggcgtgatcacatggttc gacaatttctgcgtcctgctgcgccgggacggtcagagccagcttgtctacaagcatgcg atctccaccatcatgccggcccagccgatcaacctctacgacagcgaggagtga

DBGET integrated database retrieval system