KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396593
Entry
100396593         CDS       T03264                                 
Symbol
ITGAX, CD11c
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04610  Complement and coagulation cascades
cjc04810  Regulation of actin cytoskeleton
cjc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100396593 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100396593 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100396593 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100396593 (ITGAX)
   04090 CD molecules [BR:cjc04090]
    100396593 (ITGAX)
Cell adhesion molecules [BR:cjc04515]
 Integrins
  Integrin alpha subunits
   100396593 (ITGAX)
CD molecules [BR:cjc04090]
 Proteins
  100396593 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 100396593
NCBI-ProteinID: NP_001254668
UniProt: A6N6I7
LinkDB
Position
12:29302988..29333994
AA seq 1161 aa
MTRTRAALLLFTALATSLGFNLETEQLTAFRVDSAGFGDSVVQYANSWVVVGAPHEMTAA
NQTGGLYQCSYSTGACQPISLQVPPEAVNMSLGLSLAATTSPSQLLACGPTMHHACGRNM
YLTGLCFLLAPAHLTQRLPVSMQECPRQEQDIVFLIDGSGSILYNNFAMMKSFVRAVMSH
FQRPSTQFSLMQFSSKFKTHFTFEEFRESSNPLSLLASVDQLGGYTHTATAIQKVVKELF
LASNGARREATKILIVITDGKKEGDWLDYDDVIPMADKAGIIRYAIGVGSAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
SPDGPILGAVGSFSWSGGAFLYPSNMNPTFINMSQENVDMRDSYLGYSTQLALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRRWRMKAEVTGTQIGSYFGASLCSVDMDSDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWSRWWCNAVLRGEQGHPWGRFGAALTVLGDVNGDKLMDVA
IGAPGEEEDRGAVYLFHGDSGPSISPSYSQRITGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVRASMQFIPAEIPRSVFECQEQEVSDQPLGYASICLYIDN
ISKNLLRSRDLQSSVTLDLALDPGRLSPRATFQETKSRSLSRVQVLGLQTHCENFNLLLP
ACVEDSVTPITLRLNFTLVGEPLPYFRNLQPMLATDAQRYFTASLPFEKNCGADHICQDD
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPGGLSFRHVAEGQKQGQ
LRSLRLTCDSAPAGSQGIWSTSCRINHVIFRGGAQITFLATFDISPKAVLGDQLLLVANV
SSENNTPRTSKTTFQLELPVKYAVYTVASSHEQSTKYFNFSAAEEKESRVATHRYQVNNL
GQRDLPVSINLWVPVELNQEAVWTEVEISHPQDPSLQCSSEKIAPPVSDFLVHIQKNPVL
DCTIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMSAQTMTVLEKYKIHNPTPLIVGSSVGGLLLLALITAALYKVGFFKRQYKEM
MEEANGQIAPENRTSDPQPAQ
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcactcctcctgttcacagccttagcgacttccctgggtttc
aacttggagacagagcagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtacgcgaactcctgggtggtggttggagccccccacgagatgacggctgcc
aatcaaacaggaggcctctaccagtgcagctacagcaccggggcctgtcagcccatcagc
ctgcaggtccccccggaggcagtgaacatgtccctgggcctgtccctggcggctaccacc
agcccctcccaactgctggcctgcggccccaccatgcaccacgcatgcgggaggaacatg
tacctaactggactctgcttcctcctggcccctgcccacctcacccagaggctcccagtg
tctatgcaggagtgcccgagacaggagcaggacattgtgttcctgatcgatggctcgggc
agcatcttatacaacaactttgccatgatgaagagcttcgtgagagctgtgatgagccac
ttccagagacccagcacccaattttccctgatgcagttctccagcaaattcaaaacacac
ttcactttcgaggaattcagggagagctcaaaccccctcagcctgttggcttctgttgac
cagctgggaggatacacacacacggccaccgccatccaaaaagttgtgaaagaattgttc
cttgcctcaaatggggcccgcagagaggccaccaagatcctcattgtcatcactgatggg
aagaaagaaggcgactggctggactatgatgatgtcatccccatggcggacaaagcaggc
atcatccgctatgcaattggggttggttcagcttttcaaaacagaaattcctggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcagaaccaactgaaggagaagatctttgccattgagggtaccgag
actacaagcagtagctcctttgaattggagatggcacaggaaggcttcagtgctgtgttc
tcacctgatggccccatcctgggggctgtggggagcttcagctggtctggaggtgccttc
ctgtacccctcaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccacccagttggccctgtggaagggggtacagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcgatggaggatgaaggccgaggtcacagggacccagataggctcctactttggggcc
tccctctgctctgtggacatggacagcgatggcagcaccgacctgatcctcatcggggcc
ccgcattactatgagcagacccgagggggccaggtgtccgtgtgccccttgcccaggggg
tggagcaggtggtggtgtaatgcggttctccgaggggagcagggccacccctggggccgc
tttggggcagctctgacagtactgggggacgtgaatggggacaagctgatggatgtggcc
atcggggccccaggagaggaggaggaccggggtgctgtctacctgtttcacggagactcg
ggacccagcatcagcccctcctacagccagcggatcacgggctcccagctctcctccagg
ctgcagtattttgggcaggcgctgagcgggggtcaggacctcacccaggatgggctagtg
gacctggcggtgggggcccggggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgagggcaagcatgcagttcatacctgctgagatcccccggtctgtgtttgagtgtcag
gagcaggaggtctctgaccagcccctgggatatgccagcatctgcctttacattgacaac
atttccaagaacctgctcaggagccgtgacctccaaagctctgtgaccttggacctggcc
cttgaccctggccgcctgagtccccgtgccactttccaagaaacaaagagccggagtctg
agccgagtccaagtcctcgggctgcagacacactgtgaaaacttcaatctgctgctcccg
gcctgcgtggaggactctgtgactcccatcaccttgcgtctgaacttcacactggtgggc
gagcccctcccttacttcagaaacctgcagcctatgctggccactgatgctcagagatac
ttcacagcctcccttccctttgagaagaactgtggagccgaccatatctgccaggatgat
ctcggcatctccttcagcttcccaggcttgaagaccttgctggtggggagtaacctggag
ctaaatgcagaagtgatggtgtggaacgacggggaagactcctacggaaccaccatcacc
ttctcccacccggggggactgtccttccgccacgtggcagagggccagaaacagggacag
ctgcgctccctgcgcctgacatgtgacagcgccccagctgggagccagggcatctggagc
accagctgcagaatcaaccacgtcatcttccgtgggggcgcccagatcaccttcttggct
acctttgacatctcccccaaggctgtcctgggagaccagctgcttctggtagccaatgtg
agcagtgagaacaacacccccaggaccagcaagaccaccttccagctggagctcccagtg
aagtatgctgtctacactgtggccagcagccatgaacaatccaccaagtacttcaacttc
tcagccgccgaggagaaggaaagccgtgtggccacacacagataccaggtcaacaacctt
ggacagagggacttgcctgtcagcatcaacctctgggtgcctgtggagctgaaccaggag
gctgtgtggacggaggtggagatctcccatccccaggacccatcccttcagtgctcctcc
gagaaaatcgcacccccagtgtctgacttcctggtgcacattcagaagaatcctgtgctg
gactgcaccattgccggctgcctgcggttccgctgtgacgtcccctccttcagcgtccag
gaggagctggacttcaccctgaagggcaacctcagctttggctgggtccgccagacgtcg
cagaagaaggtatcggtagtgagtgtggctgaaattacattcgacacatccgtgtactcc
cagcttccgggacaggaggcatttatgagcgctcagacgatgacggtgctggagaagtac
aagatccacaaccccactcccctcatcgtgggcagctccgtggggggtctgctgctgctg
gcgctcataacagctgcactgtacaaagttggctttttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacaggacatcagacccccagcctgcc
cagtga

DBGET integrated database retrieval system