KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400904
Entry
100400904         CDS       T03264                                 
Symbol
RIMKLA
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00250  Alanine, aspartate and glutamate metabolism
cjc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100400904 (RIMKLA)
Enzymes [BR:cjc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100400904 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100400904 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 100400904
NCBI-ProteinID: XP_002750739
Ensembl: ENSCJAG00000003106
UniProt: F7I0K3
LinkDB
Position
7:77016902..77055157
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQAGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEVRD
SSASTMGAPPSMLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgactgaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccgacagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccgtcgtcggcggccacctcggcctccagctaaaccag
aaggccctcaccaccttcccagatgtggtacttgtgcgggtacccacaccctcagtacag
tcagacagtgacatcactgtcctgcgacacctggagaagctgggctgccggttggtcaat
cgtccacagagcatcttaaattgcatcaacaaattctggacattccaagaactggctgga
catggagtccccatgccagacaccttctcctatggtgggcatgaagacttttcaaaaatg
attgatgaagctgagcccctgggctacccagtcgtggtgaagagcacacgaggccaccgg
ggaaaagctgtttttctggcaagagataaacatcacctctctgacatctgccatctgatc
cgccatgatgtaccctacctgttccagaagtacgtgaaggagtcccatggaaaggacatc
cgggtggtggtggtagggggccaggtcataggctctatgcttcgctgttccactgatgga
cggatgcagagcaactgctctctcggtggcgtaggcgtcatgtgcccgctgacagaacaa
ggcaagcagttggccattcaggtgtccaacatcctaggcatggacttctgcggcattgat
ctgcttatcatggacgatggctcctttgtggtgtgtgaggcaaacgctaatgtcggcttc
cttgcctttgaccaggcgtgcaacttagatgtgggtgggatcattgcagactataccatg
tccttgctgccaaataggcaggctgggaagatggctgtcctcccaggactgtcgagtccg
agggagaagaacgagccagatggctgtgcttcagctcagggagttgcagagagtgtctat
accatcaacagtgggtctacctctagcgaaagtgagcctgaactgggagaggtccgggat
tcctcagcaagcacaatgggggccccaccctccatgctgcccgaacctggctacaacatt
aacaacaggattgcttctgaattaaaacttaagtga

DBGET integrated database retrieval system