KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405792
Entry
100405792         CDS       T03264                                 
Symbol
CYP3A90, CYP3A5
Name
(RefSeq) cytochrome P450, family 3, subfamily A, polypeptide
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00140  Steroid hormone biosynthesis
cjc00830  Retinol metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc01100  Metabolic pathways
cjc05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100405792 (CYP3A90)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100405792 (CYP3A90)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100405792 (CYP3A90)
   00982 Drug metabolism - cytochrome P450
    100405792 (CYP3A90)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100405792 (CYP3A90)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cjc00199]
    100405792 (CYP3A90)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100405792 (CYP3A90)
Cytochrome P450 [BR:cjc00199]
 Cytochrome P450, animal type
  CYP3 family
   100405792 (CYP3A90)
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 100405792
NCBI-ProteinID: NP_001191372
Ensembl: ENSCJAG00000015744
UniProt: B1NL96
LinkDB
Position
2:12218481..12255660
AA seq 503 aa
MDLIPNLAVETWLLLALSLVLLYLYGTRSHGIFKKLGIPGPAPLPFVGNVLSYRQGIWKF
DSECHKKYGKMWGSYDGQLPVLSITDPDMIKAVLVKECYSIFTNRRPLGPVGFMKSAITV
AQDDEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKLVTMKDIFGAYS
MDVITGTSFGVNIDSLNNPKDPFVENVKKFLKFDVLAPLFLSVVLFPFLIPVFEALNFSL
FPKDAINFLKQSVNRMKKSRLNDKQKHRVDFLQLMIDSQNSNETASHKALSDLELVAQSI
IFIFAGYETTSSVLSFTIYELATNPDVQQKLQEEIDVVLPNKAPATYDAVVQMEYLDMVV
NETLRLYPITVRHERVCKKDVEINGVFIPKGALVVIPTYALHHDPKYWTEPKEFRPERFS
KKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLGVQ
GILQAEKPIVLKVESRDGTLSGE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcagtggaaacctggcttctcctggctctcagcctggtg
ctcctctatctatatgggacccgttcacatggaatttttaagaaactgggaattccagga
cctgcacctctgccttttgttggaaatgttttgtcctatcgtcaaggtatctggaaattt
gactcagaatgtcataagaagtatggaaaaatgtggggatcatacgatggtcaactccct
gtgctgtccatcacagaccccgacatgatcaaagcagtgctagtgaaagaatgttattcc
atcttcacaaaccggaggcctcttggcccagtgggattcatgaaaagtgccatcactgta
gctcaggatgacgaatggaaaagaatacgatcattgctttctccgaccttcaccagcgga
aagctcaaggagatgttccccatcattgcccagtatggagatgtgttggtgagaaacctg
aggcgggaagcagagaaaggcaagctcgtcaccatgaaagacatctttggggcctacagc
atggatgtgatcactggcacatcatttggagtgaacatcgactctctcaacaatccaaaa
gatccctttgtggaaaatgtgaagaagttcctaaaatttgatgtattagctccactgttt
ctctcagtagtactctttccgttccttatccctgtttttgaagcattaaatttctctctg
tttccaaaagatgctataaattttttaaagcaatctgtaaacagaatgaaaaaaagtcgc
ctcaacgataaacaaaagcaccgagtagatttccttcagctgatgattgactcccagaat
tcaaacgaaactgcatcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactatatatgaa
ctggccactaaccctgatgtccagcagaaactgcaggaggaaattgatgtagttttgccc
aataaggcacctgccacctatgatgccgtggtacagatggagtaccttgacatggtggtg
aacgaaacactcagattatacccaattactgttagacatgagagggtctgcaagaaagat
gttgaaatcaatggggtgttcattcccaaaggggcattggtggtgattccaacctatgct
cttcatcatgacccaaagtactggacagagcctaaggagttccgccctgaaaggttcagt
aagaagaacaaggacagcatagatccttacatatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaattaggcgtgcaa
ggaattcttcaagcagaaaaacccattgttctaaaggttgagtcaagagatggaacccta
agtggagaatga

DBGET integrated database retrieval system