KEGG   Coturnix japonica (Japanese quail): 107322841
Entry
107322841         CDS       T04297                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cjo  Coturnix japonica (Japanese quail)
SSDB
Motif
Pfam: MRAP DUF6709 FixQ EVC2_like
Other DBs
NCBI-GeneID: 107322841
NCBI-ProteinID: XP_015736836
LinkDB
Position
1:94349282..94363511
AA seq 120 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGRKLKVNKYSIVIAFWVGLAAFVMFLFLILLYM
SRSGSNPVKQVVARNRVEESNSNSEQPHCDNLSSPFSDLVAPGTPSCLPDDSGFHGSISA
NT seq 363 nt   +upstreamnt  +downstreamnt
atggccaacagaacaaactcatctgagtacttctggtcttacgaatattattgggattac
atagatccaattccagtagatggaaggaagttgaaagttaataaatattctattgtcata
gccttttgggttggacttgctgcctttgtgatgtttcttttccttattttgctctacatg
tcccgctctggatcaaatccagtgaaacaggtggtcgcaaggaaccgggtagaagaaagc
aattccaacagcgagcagcctcactgcgacaatctcagcagtccgttctcagatttggtt
gctcctggaacacccagctgccttccagatgacagtggctttcatgggagtatttcagcc
tga

DBGET integrated database retrieval system