KEGG   Clostridium sporogenes: CLSPO_c34080
Entry
CLSPO_c34080      CDS       T03905                                 
Symbol
mmgC
Name
(GenBank) acyl-CoA dehydrogenase MmgC
  KO
K24016  3-(aryl)acrylate reductase [EC:1.3.8.15]
Organism
cld  Clostridium sporogenes
Brite
KEGG Orthology (KO) [BR:cld00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLSPO_c34080 (mmgC)
Enzymes [BR:cld01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.15  3-(aryl)acrylate reductase
     CLSPO_c34080 (mmgC)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M HpaB_N
Other DBs
NCBI-ProteinID: AKC64099
UniProt: A0A1V9IPT0
LinkDB
Position
complement(3707191..3708324)
AA seq 377 aa
MFFTEQHELIRKLARDFAEQEIEPIADEVDKTAEFPKEIVKKMAQNGFFGIKMPKEYGGA
GADNRAYVTIMEEISRASGVAGIYLSSPNSLLGTPFLLVGTDEQKEKYLKPMIRGEKTLA
FALTEPGAGSDAGALATTAREEGDYYILNGRKTFITGAPISDNIIVFAKTDMSKGTKGIT
TFIVDSKQEGVSFGKPEDKMGMIGCPTSDIILENVKVHKSDILGEVNKGFITAMKTLSVG
RIGVASQALGIAQAAVDEAVKYAKQRKQFNRPIAKFQAIQFKLANMETKLNAAKLLVYNA
AYKMDCGEKADKEASMAKYFAAESAIQIVNDALQIHGGYGYIKDYKIERLYRDVRVIAIY
EGTSEVQQMVIASNLLK
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtttttcacagaacaacatgaacttattagaaaattagcaagagattttgcagagcag
gaaatagagcctattgcagatgaagtagataaaactgccgagttccctaaagaaattgtg
aaaaaaatggcccaaaatggtttttttggaataaaaatgcctaaagaatatggtggagct
ggagcagataatagagcctatgtaactataatggaagagatatcaagagcatctggtgta
gctggtatatatttatcatcaccaaattcattgcttggcacaccgttcctactagttggt
acagatgaacaaaaggaaaaatatctaaaaccaatgattagaggagaaaaaacattagct
tttgctttaacagaaccaggtgcaggttcagacgcaggagcacttgcaacaactgctaga
gaagaaggggactattatatattaaatggaagaaaaacttttattacaggagctccaata
tctgataatatcatagtgttcgcaaaaacagatatgagcaaaggaacaaagggaattact
acatttatagtagatagtaaacaggaaggtgtatcttttggtaaacctgaagacaagatg
ggtatgattggttgccctactagtgatattattttagagaatgtaaaggttcataaatct
gatatacttggagaagtaaataaaggctttataacagcaatgaagactttaagtgttggt
cgtataggagttgcttctcaagctttaggaatagcacaagctgctgtagatgaagctgtt
aaatatgcaaaacaaagaaaacaatttaatagacctatagcaaaatttcaagctattcaa
tttaaattggctaacatggaaacaaaattaaatgcggcaaaattattagtgtataatgct
gcttataaaatggattgtggagaaaaggcagataaagaagcttctatggcaaaatatttt
gctgctgaatctgctatacaaatcgtaaatgacgcactacaaatccatggtggttatgga
tacataaaagattataaaatagaaagattatatagagatgttagagtaattgctatatat
gaaggaacttctgaagttcaacaaatggtaatcgcatcaaatcttttaaagtaa

DBGET integrated database retrieval system