Canis lupus dingo (dingo): 112649884 Help Entry 112649884         CDS       T08371                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism clud  Canis lupus dingo (dingo) Pathway clud03030   DNA replication clud03082   ATP-dependent chromatin remodeling clud03410   Base excision repair clud03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:clud00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     112649884 (POLE3)    03410 Base excision repair     112649884 (POLE3)    03420 Nucleotide excision repair     112649884 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112649884 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:clud03032]     112649884 (POLE3)    03036 Chromosome and associated proteins [BR:clud03036]     112649884 (POLE3)    03400 DNA repair and recombination proteins [BR:clud03400]     112649884 (POLE3) Enzymes [BR:clud01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      112649884 (POLE3) DNA replication proteins [BR:clud03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     112649884 (POLE3) Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     112649884 (POLE3) DNA repair and recombination proteins [BR:clud03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       112649884 (POLE3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 CIS_TMP SpoU_methylase PPP4R2 DUF5427 TAF DUF4746 RNA_pol_3_Rpc31 Pox_Ag35 Myc_N DUF6080 CDC45 DDHD NOA36 V_ATPase_I Motif Other DBs NCBI-GeneID:  112649884 NCBI-ProteinID:  XP_025288198 Ensembl:  ENSCAFG00020022781 LinkDB All DBs Position 11:complement(67277553..67280176) Genome browser AA seq 147 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDAEEQD KGRDEDNDEDEERLEEEEQNEEEEVDN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggagaggcccgaggacctaaacctgcccaatgctgtcatcaccaggatcatcaag gaagcgctcccggacggtgtcaacatctccaaggaggcccgcagcgccatctcccgcgcc gctagcgtcttcgtgctgtacgccacttcctgtgccaacaacttcgcgatgaagggaaaa cgcaagacgttgaacgccagtgacgtgctctcagccatggaggagatggagttccagcgg ttcgtcacccccctgaaagaagctctggaagcgtacaggagagagcagaaaggcaagaag gaagcttccgagcagaagaagaaggacaaagacaaaaaaaccgatgcagaggagcaagac aagggcagagatgaggacaacgatgaagacgaagaaaggctggaagaagaagaacagaac gaagaggaggaagtagacaactag

DBGET integrated database retrieval system