Canis lupus dingo (dingo): 112677962 Help Entry 112677962         CDS       T08371                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism clud  Canis lupus dingo (dingo) Pathway clud01522   Endocrine resistance clud04110   Cell cycle clud04115   p53 signaling pathway clud04151   PI3K-Akt signaling pathway clud04218   Cellular senescence clud04530   Tight junction clud04660   T cell receptor signaling pathway clud04933   AGE-RAGE signaling pathway in diabetic complications clud04934   Cushing syndrome clud05160   Hepatitis C clud05162   Measles clud05163   Human cytomegalovirus infection clud05164   Influenza A clud05165   Human papillomavirus infection clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05169   Epstein-Barr virus infection clud05200   Pathways in cancer clud05203   Viral carcinogenesis clud05212   Pancreatic cancer clud05214   Glioma clud05218   Melanoma clud05219   Bladder cancer clud05220   Chronic myeloid leukemia clud05222   Small cell lung cancer clud05223   Non-small cell lung cancer clud05224   Breast cancer clud05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     112677962 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     112677962 (CDK4)    04115 p53 signaling pathway     112677962 (CDK4)    04218 Cellular senescence     112677962 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     112677962 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     112677962 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112677962 (CDK4)    05203 Viral carcinogenesis     112677962 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     112677962 (CDK4)    05225 Hepatocellular carcinoma     112677962 (CDK4)    05214 Glioma     112677962 (CDK4)    05220 Chronic myeloid leukemia     112677962 (CDK4)    05218 Melanoma     112677962 (CDK4)    05219 Bladder cancer     112677962 (CDK4)    05224 Breast cancer     112677962 (CDK4)    05222 Small cell lung cancer     112677962 (CDK4)    05223 Non-small cell lung cancer     112677962 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112677962 (CDK4)    05160 Hepatitis C     112677962 (CDK4)    05164 Influenza A     112677962 (CDK4)    05162 Measles     112677962 (CDK4)    05163 Human cytomegalovirus infection     112677962 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     112677962 (CDK4)    05169 Epstein-Barr virus infection     112677962 (CDK4)    05165 Human papillomavirus infection     112677962 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112677962 (CDK4)    04934 Cushing syndrome     112677962 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     112677962 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:clud01001]     112677962 (CDK4) Enzymes [BR:clud01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      112677962 (CDK4) Protein kinases [BR:clud01001]  Serine/threonine kinases: CMGC group   CDK family    112677962 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  112677962 NCBI-ProteinID:  XP_025332609 Ensembl:  ENSCAFG00020022861 LinkDB All DBs Position 10:complement(2074772..2077742) Genome browser AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQTVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctactcctcggtacgagccagtggctgagattggggttggtgcctatggaacggtg tacaaggcccgtgatccgcacagcggccacttcgtggccctcaagagcgttagagtccct aatggaggaggtgccggagggggccttcccatcagcacagttcgtgaagtggcattgctg aggcggctggaggcttttgagcatcccaacgttgtccggctaatggacgtctgcgccact gcccgaaccgaccgggagaccaaagtgaccctggtgtttgagcacgtggaccaagacctg agaacgtacctggacaaggcacccccaccgggcttgccagtggagaccatcaaggatctg atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac ctgaagcccgagaacattctggtgaccagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat cgtgctccagaagttcttctgcagtctacgtatgcaacacccgtggacatgtggagtgtc ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgatctgatcgggctgcccccagaggatgactggccccga gatgtgtctctgccccgaggagccttttcccctagagggccccgtccagtacagacagtg gtacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt aacccagagtga

DBGET integrated database retrieval system