KEGG   Clavispora lusitaniae CBS 6936: A9F13_03g02684
Entry
A9F13_03g02684    CDS       T05147                                 
Name
(GenBank) putative kinetochore protein
  KO
K12575  kinetochore protein SLK19
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus04111  Cell cycle - yeast
clus04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:clus00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    A9F13_03g02684
   04113 Meiosis - yeast
    A9F13_03g02684
SSDB
Motif
Pfam: Fungal_TACC CCDC22 Crescentin Fib_alpha WD40_alt
Other DBs
NCBI-ProteinID: OVF10123
LinkDB
AA seq 696 aa
MPHDSLSSEERLSPIKLAAFDSASRTQSDEIQRKVSASADLSSRSAFGLIKHPHGLQAKH
EYRRNTLNHPSSFKTPAKPTTRDVVTSPRLVAPVLQPDNTDSIADSPSYRIRSKRVTEKV
DNDSNPLLIGNGTTKKTQTEHNSNKRPSSGEISSSVFKQSRLSSAGKSHGANTSDSSSHN
ELLERMNSSPENINHGDDPAMSLTEKQFGDDLMENHDSRISESNQPGVIVHLNDTPIYTA
HQMEMSRQSLLSEIVKMEASVVEKNDEIIELTSAVSNAKNRILRLEEGINEKSRAESHLK
ESVHLLDLQIDHINKELSQVKSDLKVKSALLQSSEDKLKDLKEGFDEERRTLNDTIVKLE
GHAQELEVVLAERSSEISTLKAEIEGIKLEKERLFRDRDSLSVELEKILASNESLLSKLK
AAEDEREHLASQLQMKERSLSEKNDQLKDLDEKFKELCEEASSLHNEMAKLETEQKSKDE
EILKKDHLLEQSKVHCTQLEGEVTSLKDELKSNRDLYQKDTNITSSLQSEIDHLMKKVED
LQNQNLEKDQIISGDTKKLTELVEEVTKQKQVISELKTKVTNKDESASETELLRQIASLK
HQVSTAQQKTDERIQDVAEQLYHQYSKKHELKVNQLKEKYDAKIEDSHRELEQKRREIET
LDSQLKTEMKEKNYLLSVLEKSDSTFNKRTPTRNRY
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgcctcacgatagcttgtccctggaggaaagactttccccaataaaactagcggcattt
gattctgcttcacgaacacaatctgatgagattcagagaaaagtgagtgcatccgcggat
ttgtcctctcgatcagcatttggtctcattaagcaccctcatggacttcaggcaaaacac
gaatatcgcagaaatactttgaaccacccaagctcattcaagacgccagctaagccaaca
actagagatgttgtgacatctccgcgtttggtggcacctgtcttgcaaccagataatacg
gactctattgcggacagtccttcttatagaattagaagcaagcgggtcactgaaaaggtc
gacaatgattcaaatccccttttaattggaaacggtactacgaaaaagactcaaactgaa
cataactcaaacaagagaccttcttcaggagaaatttcgctgtccgtatttaaacagtcc
agactttcgtccgccggaaagtcgcatggtgctaacacctccgattcatcttctcacaac
gagttgcttgaacgaatgaatagtagccctgagaatatcaatcatggagacgaccctgcg
atgagcctcacagagaagcagttcggtgacgacctcatggagaatcatgattcacggatc
ctggaaagtaaccagcctggtgtcattgtgcatttaaatgatacccccatttatactgct
caccaaatggagatgtcaaggcaaagtctattgagtgaaatagtgaagatggaagctagt
gttgttgagaaaaatgacgagataattgaacttaccagtgctgtgagtaatgcaaagaat
agaattttgcgtcttgaagagggaatcaacgaaaaactgcgagctgaatcacatctcaaa
gagagtgttcatctcctagatttgcaaattgatcacatcaataaggaattgagccaagtt
aaactggatttgaaagttaaatcggctcttttacagtcttccgaggacaagctcaaagat
ttaaaagaagggtttgatgaggaaagacgtacgttgaatgacacgattgtcaaactagag
ggccatgcacaggaacttgaggttgtccttgcggaaagaagcctggaaatatctacattg
aaagcggaaattgagggtataaaattggagaaggagaggttattcagagatagagactca
ttaagtgttgaacttgaaaaaattttagcgtccaatgaatcactactatctaagcttaag
gcagcggaagatgaaagagagcatttagccctgcagttacaaatgaaagaaagatcattg
tctgaaaaaaatgatcaacttaaagatttggacgagaaatttaaggaactatgtgaggaa
gcgagtagcctacataacgaaatggctaagcttgagacagaacagaaatcgaaggatgag
gaaattttgaaaaaagatcaccttttagaacaactgaaggtgcactgtacgcaacttgaa
ggagaggttacttcgttaaaagatgaacttaaatcgaatcgcgacttatatcaaaaagat
actaatattacttcgagtcttcaatcagaaatcgatcatttgatgaagaaagtggaggat
ctacaaaatcaaaaccttgagaaagatcaaataatcagcggagatacaaaaaaactcaca
gaattggtggaagaagttacgaaacaaaaacaagtgatttcagagctcaaaacaaaggta
acgaataaggatgaatcagcctctgaaactgaactacttagacaaatagcaagcctcaag
catcaggtctccactgctcaacagaaaactgatgaaagaattcaagatgttgctgagcaa
ttataccatcagtactccaagaagcatgaattgaaagtcaaccaattaaaggaaaagtat
gatgctaaaatcgaggacagccatcgtgagcttgagcaaaagcggcgtgaaattgaaact
ttagatagccaattgaagactgaaatgaaggagaagaactaccttctttcagtcttggag
aaatcggatagcactttcaacaagcgtaccccaacaagaaataggtactga

DBGET integrated database retrieval system