KEGG   Clavispora lusitaniae CBS 6936: A9F13_10g01397
Entry
A9F13_10g01397    CDS       T05147                                 
Name
(GenBank) putative G1/S-specific cyclin
  KO
K06646  G1/S-specific cyclin CLN3
Organism
clus  Clavispora lusitaniae CBS 6936
Pathway
clus04111  Cell cycle - yeast
clus04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:clus00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    A9F13_10g01397
   04113 Meiosis - yeast
    A9F13_10g01397
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-ProteinID: OVF07997
LinkDB
AA seq 450 aa
MSTSPGIFHNVRVSQAALKASNIKVQLAEYNAHKKQVDEYKLDIYQHLLELDTSTRPNLQ
LIQQQPEINLRMRPLLLDFLMDVINKLNASKATFPLAVNLIDRYCSVRIVKKQHYQLLGL
TALWIACKNLDSKFRVPTLNDLCRYCCNCYDKKLFLEMENHVLKSLKWLVDAPTFDAFID
VYIHTLASSPFLAGSKNPHKVCNDVKIVAIYICELIQFYPNIYFNYTTPKIALLSVLMSC
LILNVGENFVVKDFLDHVYISTMVSVVSVQDFCQAFGLLIKVLKCPPPSLKTKYFNEDSR
FLSHMKLLVSFTLTHLAENSVFSQTGSAPLSSCVTPVASRPASNRSYSGEHQMKTPRLGS
GVTTPKFYPATPISSSISPKNSELDHFEKSRPMCSPAIGYRGYGSFNGRPLPSPADSEND
IPGTKRSFEAVAPPAIKRSKSTSDRSVFLL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagcacttccccaggtattttccataatgttcgtgtttctcaagccgctttgaaagct
tcaaacatcaaggtccaattagcagaatacaatgctcacaagaaacaggttgacgagtac
aaattggacatctaccagcatttattggagttggacaccagtaccagacccaatctccag
ttgatacaacagcagccggaaatcaacttgcgcatgagaccattgttgcttgacttcttg
atggatgtgatcaacaaattgaatgcttccaaagccactttccctttggccgtgaatctt
attgaccggtactgctcggtccgcattgtcaagaaacagcactaccaacttttagggctc
acggcactctggattgcttgcaagaatttggattccaagttccgggtgccaactttgaat
gacttgtgccgttactgttgcaattgctatgataagaagttgttcttggaaatggaaaac
catgttctaaagtctttgaaatggctcgtggacgcccctacttttgatgcatttatcgac
gtctacatccacaccttggcctcgtccccgtttttagcaggatctaaaaacccacacaag
gtgtgcaatgacgtcaagatcgtggctatttacatctgtgagttgattcagttttacccc
aacatctacttcaactacactactccaaagattgcattgttaagcgttttgatgtcgtgc
ttgatccttaatgttggcgagaatttcgtggtgaaggatttcctcgaccatgtgtacatc
tcgaccatggtttcggttgtgctggttcaggatttctgccaggcctttgggttgcttatc
aaagtgttgaagtgccctccaccctcgcttaagaccaagtacttcaacgaggatctgcgc
ttcctcagccacatgaagttattggtttcgtttaccttgacgcacttggcagagaactct
gtcttttctcaaacagggtctgcgccattgtcgtcttgcgttacgcccgttgcttcaaga
ccggcctccaacagatcgtactctggcgagcatcaaatgaaaactcccaggttaggaagc
ggcgtcaccactcccaaattctatccagccacgccgatcctgctgagcatcagccctaag
aactcggagttagaccatttcgaaaagtctcggccaatgtgtctgccggctataggctac
aggggatacggatcttttaacggacggcctcttcccctgcccgcagacctggagaacgat
attcccggcacaaaaagaagctttgaagccgttgcacctccagcgatcaaaagatcaaag
agcaccagcgaccggtccgtgtttttgctctag

DBGET integrated database retrieval system