Columba livia (rock pigeon): 102090127 Help Entry 102090127         CDS       T02912                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism clv  Columba livia (rock pigeon) Pathway clv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:clv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102090127 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:clv04121]     102090127 (ELOC)    03400 DNA repair and recombination proteins [BR:clv03400]     102090127 (ELOC) Ubiquitin system [BR:clv04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      102090127 (ELOC)    Cul5 complex      102090127 (ELOC) DNA repair and recombination proteins [BR:clv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102090127 (ELOC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  102090127 NCBI-ProteinID:  XP_005509270 UniProt:  A0A2I0MWE7 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacatacggtgggtgtgagggcccggatgctatgtatgtgaag ttaatatcctccgatggccatgagttcattgtaaaaagagagcatgcattaacatcagga acaataaaagctatgttgagtggaccaggacagtttgcagaaaatgaaacaaatgaggtg aattttagagagattccatcccatgtcctatccaaagtatgcatgtatttcacctacaag gtccgctatactaacagctctacggagattcctgaattcccaattgcacctgaaattgca ctggaacttctgatggctgcaaacttcttagattgttaa

DBGET integrated database retrieval system