Chitinibacter mangrovi: ABHF33_15835 Help Entry ABHF33_15835      CDS       T11125                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism cmav  Chitinibacter mangrovi Pathway cmav02024   Quorum sensing cmav03018   RNA degradation Brite KEGG Orthology (KO) [BR:cmav00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ABHF33_15835 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ABHF33_15835 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmav03019]     ABHF33_15835 (hfq)    03036 Chromosome and associated proteins [BR:cmav03036]     ABHF33_15835 (hfq) Messenger RNA biogenesis [BR:cmav03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ABHF33_15835 (hfq) Chromosome and associated proteins [BR:cmav03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ABHF33_15835 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  XBM00506 UniProt:  A0AAU7F9Z4 LinkDB All DBs Position 3360996..3361247 Genome browser AA seq 83 aa AA seqDB search MSAKGQMLQDPFLNILRKEHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STVVPSRSVNVPHDNPAAAATEN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtgctaaggggcaaatgttgcaagatccttttttgaacatcttgcgcaaagagcat gtgccagtgtcaatttacctggtcaatggcatcaagctgcaagggcagatcgaatcattt gatcagtatgttgttttgctgcgtaataccgtcacgcaaatggtttacaaacacgccatt tcaaccgtggtgccttcacgttcggtgaatgtgccgcatgacaatccggctgctgcagca actgagaactga

DBGET integrated database retrieval system