Chamaesiphon minutus: Cha6605_3091 Help Entry Cha6605_3091      CDS       T02414                                  Name (GenBank) ATP synthase, F0 subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism cmp  Chamaesiphon minutus Pathway cmp00190   Oxidative phosphorylation cmp00195   Photosynthesis cmp01100   Metabolic pathways Module cmp_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cmp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Cha6605_3091    00195 Photosynthesis     Cha6605_3091  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cmp00194]     Cha6605_3091 Photosynthesis proteins [BR:cmp00194]  Photosystem and electron transport system   F-type ATPase [OT]    Cha6605_3091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AFY94113 UniProt:  K9UHI4 LinkDB All DBs Position 3248414..3248659 Genome browser AA seq 81 aa AA seqDB search MNPTVAAASVIAAALAVGLASIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLILSLAFM ESLTIYGLVVALILLFANPFS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatcctactgttgctgctgcttctgttatcgctgctgctcttgctgtcggtctagct tcgatcggtcctggtatcggtcaaggcaacgctgctggacaagctgttgaagggattgca cgtcaacccgaagcggaaggcaaaattcgcggtacgcttattctttccttggcgttcatg gaatccttgacaatctacggtctggttgtcgcgctgattctcttgtttgctaaccctttc tcctag

DBGET integrated database retrieval system