Cryptococcus deneoformans B-3501A: CNBA6190 Help Entry CNBA6190          CDS       T01040                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism cnb  Cryptococcus deneoformans B-3501A Pathway cnb03022   Basal transcription factors cnb03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cnb00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     CNBA6190   09124 Replication and repair    03420 Nucleotide excision repair     CNBA6190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cnb03021]     CNBA6190    03400 DNA repair and recombination proteins [BR:cnb03400]     CNBA6190 Transcription machinery [BR:cnb03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      CNBA6190 DNA repair and recombination proteins [BR:cnb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      CNBA6190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  4933883 NCBI-ProteinID:  XP_777741 LinkDB All DBs Position 1:1725497..1725807 Genome browser AA seq 67 aa AA seqDB search MSADSYNVKITSGVLVTCDSAAKQILLHLDSMRDGPHKFVIRDVDENRVMVKKEYVEMLK DELQNEV NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagacagctacaacgtcaagatcacctcgggcgtcctcgtcacctgcgactcg gccgcaaagcagatcttgctgcatttggactcgatgcgggacggtccccacaagtttgtc atccgtgacgttgacgagaaccgtgtgatggtcaaaaaggaatacgtcgaaatgctcaaa gacgagcttcaaaacgaggtgtga

DBGET integrated database retrieval system