KEGG   Cupriavidus oxalaticus: E0W60_36440
Entry
E0W60_36440       CDS       T06004                                 
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
cox  Cupriavidus oxalaticus
Pathway
cox00361  Chlorocyclohexane and chlorobenzene degradation
cox01100  Metabolic pathways
cox01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cox00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    E0W60_36440
Enzymes [BR:cox01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     E0W60_36440
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N DUF5706
Other DBs
NCBI-ProteinID: QBY56508
UniProt: A0A4P7LLR8
LinkDB
Position
unnamed5:complement(join(88776..89459,1..84))
AA seq 255 aa
MNKRVKDVVDAIVAAVQRVLDQKEVTEAEYRTAVHYLMQVAEQRETALLCDVFFNSTVAA
TKARISEGSTPAIEGPYYRDDAPLVDDRLKTYDTDDHKPLLIQGTVKAVDGSVVEDVTID
VWHSTPDGKYSGFHDDIPTDFYRGKLRVGTDGSFRVRTTMPVPYQIPDQGPTGALLETMG
GHSWRPAHVHFKVKAPGYETLTTQYYFEGGDWITDDCCNGVQSSLITPDIVEEGVRLMNI
NFVIEPARAQAGANP
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgaacaaaagagtcaaggatgttgtcgatgcgatcgtcgcggcggtacagcgggtgctc
gaccagaaggaggttactgaggcggaataccgaactgcggttcattacctcatgcaagta
gccgaacagcgtgaaaccgctcttctttgcgatgtttttttcaatagcaccgtggctgcg
acgaaggctcgtattagcgaaggttcaacgcctgctatcgagggaccctactatcgcgac
gacgcccctctggtcgatgaccggctcaagacttacgacacggacgaccacaagcctttg
cttatccagggaacggtcaaagcggtcgacgggagcgttgtcgaggacgtgacgattgat
gtctggcattcgacgcccgatgggaagtacagcggtttccatgacgacatcccgactgat
ttttatcgagggaagctcagggtgggcaccgatggcagcttccgcgtgcgcacaacgatg
ccggtgccgtatcagatcccggatcagggtcccacgggcgcattgctcgaaaccatgggt
ggtcactcgtggcgtcccgctcatgtacatttcaaggtgaaggcgccgggatatgaaacg
ttgaccacgcagtactacttcgaaggtggagattggatcacggacgactgttgcaacggc
gtccagtctagtctgattactcccgatattgtggaagagggtgtccgcctgatgaacatc
aacttcgttatcgagcccgcgcgtgcgcaggcgggggcaaacccgtga

DBGET integrated database retrieval system