KEGG   Carica papaya (papaya): 110818289
Entry
110818289         CDS       T05151                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00380  Tryptophan metabolism
cpap00966  Glucosinolate biosynthesis
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
cpap01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    110818289
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    110818289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cpap00199]
    110818289
Enzymes [BR:cpap01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     110818289
Cytochrome P450 [BR:cpap00199]
 Cytochrome P450, plant type
  CYP83 family
   110818289
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110818289
NCBI-ProteinID: XP_021902795
LinkDB
Position
Unknown
AA seq 496 aa
MDWVILLAALPLLLVLVFQKYKNAPRLPPGPKGLPFIGNLHQMESHNPQHFMHRLSKIYG
PIMSFKIGSKRVVVVSSAELAKEALKTQDLNFCNRPLLCGQQKMSYKGLDLGFGQYTPYY
REMRKLYVINLFSPKTVQSFSPVRVDEVSRMMDKMTKAALKAEIIDLSEMMLSFTNAVVC
RTAFGKRYAEYGEEMRRFIELLYETQAMLGVFFFTDYFPYLGWLDHFTGLRSRLNKAAKA
LDIFLQGIINERLDPNMPKPEKECLIDLLLQFCKDQPFSSVEFTHQNVKALIMDVVIAGT
DTAAAAVVWAMTYLMKNPEALKKVQEEVRSLVGDRGYVTEDDVPNLTYMKAVVKEALRLE
PVIPLLLHREALEDCKIGGYDIPAKTILQVNAWAIARDREAWGQNPEEFRPERYIDKPVD
YKGQDFELIPFGSGRRMCPGMHLGVAMLELPFANLLYKFDWELPPGVKAEEIKMDVMTGL
AMHKKDHLLLLPKKHI
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggattgggtgatcttgctagcagcacttcctcttttactggttcttgtcttccaaaaa
tacaaaaatgcgcctcgtctacctccaggcccgaaggggcttccctttattggcaactta
caccaaatggaaagccacaaccctcaacatttcatgcacaggctctccaagatttatggt
ccgatcatgtcattcaagattggttcaaagcgagtggtggtggtgtcctcggccgaactg
gctaaggaggcgctcaaaacccaagacctaaacttttgtaacaggcccctcctctgcggc
cagcagaagatgtcttacaagggcttggatctgggttttggccaatacactccttactat
agggagatgaggaaactctatgtgatcaacctcttcagccctaaaaccgttcaaagcttt
agtcccgtaagagttgatgaagtgtcccgtatgatggacaagatgaccaaagctgctctc
aaggctgagatcatcgacttgagcgaaatgatgttgtcgtttactaacgctgtggtttgc
aggacggcttttggtaaaagatacgccgagtatggagaagaaatgagaaggtttatcgag
ttgttgtacgagacacaagccatgttgggagttttctttttcactgattactttccttat
ttgggttggcttgatcattttaccggactccgctctcgccttaacaaagctgccaaagca
cttgatatcttcttgcaaggaatcatcaacgagcgactcgacccaaacatgcccaaaccc
gagaaggagtgccttattgaccttttactccagttttgcaaggatcaaccattttcatca
gtcgagttcactcatcaaaacgtcaaggcactcatcatggacgtagttattgctggaacg
gacaccgcggcagctgcagtggtctgggcgatgacctacctaatgaagaatccggaagcc
ctgaagaaagttcaagaagaagtgagatcgttagttggggatagagggtatgtgactgaa
gatgacgttccaaatctaacatacatgaaagctgtagtaaaagaagcgttgagattggaa
ccggtgatccctttgctactacatcgggaagcactagaggactgcaagatcggaggctat
gacataccggccaaaacgatacttcaagtgaatgcgtgggcaatcgccagggaccgtgaa
gcttgggggcagaacccagaagagtttcgaccagagaggtacatagacaagcccgttgac
tataaaggtcaagacttcgagctaataccatttgggtccggacgaagaatgtgtccgggc
atgcacttgggagttgccatgctggagcttcctttcgcaaatttgctttacaagtttgat
tgggaattgcctcccggggttaaagcagaggagattaaaatggatgttatgaccggctta
gccatgcacaagaaggatcatctcttgcttttgcctaagaagcacatatga

DBGET integrated database retrieval system