Cnuibacter physcomitrellae: B5808_10345 Help Entry B5808_10345       CDS       T04797                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism cphy  Cnuibacter physcomitrellae Pathway cphy00190   Oxidative phosphorylation cphy01100   Metabolic pathways Module cphy_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cphy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     B5808_10345  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cphy00194]     B5808_10345 Photosynthesis proteins [BR:cphy00194]  Photosystem and electron transport system   F-type ATPase [OT]    B5808_10345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N DUF4837 ADH_N Motif Other DBs NCBI-ProteinID:  ARJ05581 UniProt:  A0A1X9LNP7 LinkDB All DBs Position complement(2183649..2183915) Genome browser AA seq 88 aa AA seqDB search MANPLAVTVVAADREIWKGEASMVVAKTVEGEIGILAGHEPMLAILASGEVRVNASSGER IVARADDGFLSVENDTVTVVARDAELIR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcgaacccgcttgccgtcaccgtcgtcgccgccgatcgcgagatctggaagggcgag gcctcgatggtcgtcgcgaagaccgtcgagggcgagatcggcatcctcgccggtcacgag ccgatgctcgcgatcctggcctcgggtgaggtgcgcgtgaacgcctcgagcggcgagcgc atcgtggcccgagcggatgacgggttcctgtcggtcgagaacgacacggtcaccgtggtc gcccgcgacgcggagctcatccgctag

DBGET integrated database retrieval system