KEGG   Culex pipiens pallens (Northern house mosquito): 120417093
Entry
120417093         CDS       T07310                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
cpii  Culex pipiens pallens (Northern house mosquito)
Pathway
cpii00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:cpii00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    120417093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cpii00199]
    120417093
Enzymes [BR:cpii01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     120417093
Cytochrome P450 [BR:cpii00199]
 Cytochrome P450, animal type
  CYP306 family
   120417093
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 120417093
NCBI-ProteinID: XP_039435006
LinkDB
Position
Unknown
AA seq 506 aa
MYLLLIITTIVIYSIWTILDRRGKPPGPFGLPVVGYLPFFDSQKPYETLTKLSAKYGPIF
GLHMGQVYAVVLTDPSLIRDALKREELTGRAPLFITHGIMGGQGIICAEGNLWRDQRRLS
SEWLRKMGMTKFGPARATLEARIVAGVNELVQDLKAESEKVFAFDPAPFVHHILGNLLND
LVFGLRYDRDDETWRYLQHLQEEGVKHIGVSMAVNFLPFLRHLPASKRIIEFLLNGKAKT
HKIYDSIIEERRRALPEDAGDGGDQEGKVNDPANGDCILTNFVQETRRREAAGRPELAFC
SDAQLRHLLADLFGAGVDTTFTSLRWLLLFVALDRDVQQRLRRELCALQREPTLNDIDSL
PYLKACVAEAQRLRTVVPLGIPHGTVSDTNIAGFKIPKGAMIMPVLWAVHMNPDLWSDPD
RYNPEHFLDESGQYVAPAHFLPFQTGKRMCLGDELARMILYLYTARIFWHFELDVFDGKA
VDLTGICGITLAPPAYEIIFKKCSPK
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtacttacttttgatcataaccacgattgtcatttactcaatttggaccattctcgat
cgtcgcggcaaacctccaggaccatttggtctccccgtggttggttatttgccatttttc
gattcccaaaaaccgtacgaaacactcaccaagctcagcgccaagtatggcccgatcttt
ggacttcacatgggccaggtgtacgcagtcgtcctgacggatccctccctcatccgggac
gccctgaagcgcgaagagctgaccggacgtgccccgctcttcatcacccacggtatcatg
ggaggacagggaatcatctgcgcagaaggcaatctgtggcgcgatcaacggcgtctgtct
agcgagtggctgcgcaagatgggcatgactaaattcggcccagcccgggcgaccctcgag
gcccgcatcgtagccggtgtgaatgaactcgtacaggacctaaaggcggaatcagagaaa
gtgtttgcctttgatcctgcaccatttgtgcaccacattctaggaaatctactgaatgac
ctcgtgtttgggctgcggtacgatcgggacgacgagacgtggcgataccttcagcaccta
caggaggaaggcgtcaagcacattggcgtttcaatggcggtcaatttcctgccattttta
agacatctgcctgcgagcaaaaggataattgaatttttattaaatggcaaagcaaaaact
cataaaatttacgactcgatcatcgaagagcgacgcagagcactgcctgaggatgcaggc
gacggtggcgaccaggagggaaaggtcaatgacccggccaacggcgattgcattctaaca
aatttcgtgcaagagactcgtcggcgggaagcggccggccgtccggagttggccttctgc
agtgacgcccagctgaggcatcttttggctgatcttttcggggcaggtgttgatacaacg
ttcaccagtttgcgctggctgttgctctttgtagcgctcgatcgagacgtacaacagcgg
ctgcggcgtgaactttgcgctctgcagcgtgagccaacgctcaacgatattgattcgctg
ccttatttgaaagcttgcgtggccgaggctcagcgattgagaacggtggtgcccctcggt
atcccacatggcactgtttcggacaccaatatcgctggcttcaaaatccccaaaggagcg
atgatcatgcccgtgctgtgggccgtccacatgaaccctgatctgtggtccgaccccgat
cgttacaatccggaacactttctggacgaatctggccagtatgttgctcccgcgcacttt
ctgccttttcaaaccggcaagcgaatgtgtctcggtgacgaactggcccgtatgatcttg
tatctttacaccgcccgaatcttttggcactttgagctggacgttttcgacggcaaggcg
gtcgacttgaccggaatctgcggaatcacgctggctccaccagcgtatgaaatcatcttt
aagaagtgctcgcccaagtga

DBGET integrated database retrieval system