KEGG   Cavia porcellus (domestic guinea pig): 100713055
Entry
100713055         CDS       T07777                                 
Symbol
Rimkla
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc00250  Alanine, aspartate and glutamate metabolism
cpoc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100713055 (Rimkla)
Enzymes [BR:cpoc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100713055 (Rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100713055 (Rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Rimk_N
Other DBs
NCBI-GeneID: 100713055
NCBI-ProteinID: XP_003462549
Ensembl: ENSCPOG00000005184
UniProt: H0V4V8
LinkDB
Position
Unknown
AA seq 391 aa
MCSQVWLLTDRRLSEDYPQVQILRALRQRCSEQDVRFRAVFMDQLAVTVVGGHLGLQLNQ
KALTTFPDVVVVRVSTPSVQSDSDITVLRHLEKLGCRLVNSSQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHDDFSKMIDEAEPLGYPVVVKSTRGNQGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYSM
SLLPNRQTGKMAVLPGLSSPREKKEPDGCASAQGVAESVYTINNGSTSSESEPELGEVRD
SSANTKGGPPPVLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccaggtctggctcctaacggaccggcgtctcagcgaggattacccgcaggtg
cagattctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ttcatggaccagctcgccgtcaccgtcgtcggcggccacctcggcctgcagctgaaccag
aaggccctcactactttcccagacgtggtggtcgtgcgggtgtccacaccctccgtgcag
tcggacagcgacatcactgtcctgaggcacctggagaagctgggctgccgcttggtcaac
agctcacaaagcatcttaaactgcatcaacaaattctggacgttccaagagctggccgga
catggggtccccatgccagacaccttctcgtacggtggacatgacgacttttcaaaaatg
attgacgaggctgagcccctgggttacccggtcgtggtgaagagcacgcgaggcaaccag
ggaaaagctgtttttctggcaagagacaaacatcacctctcagacatctgccacctgatc
cgccatgatgtgccctacctgtttcagaaatacgtgaaggagtcccacggaaaagatatc
cgggtggtggtggtcgggggccaggtgataggctccatgcttcgctgctccacagacgga
cggatgcagagcaactgctctctgggtggcgtgggcgtcatgtgccccctgacagaacaa
ggcaagcagctggccattcaggtgtccaacatcctgggcatggacttctgtggcatcgat
cttctcatcatggacgatggctcctttgtggtgtgcgaagccaatgccaacgtcggcttc
ctggccttcgaccaggcgtgcaacttagacgtgggagggatcattgcagactattccatg
tctttgctgccaaaccggcagaccgggaagatggccgtcctcccaggactgtcgagcccc
agggagaagaaggagccagatggctgtgcttcagctcagggagtcgcagagagcgtctac
accatcaacaatgggtctacctctagtgagagtgaacctgaactgggagaggtccgggat
tcctccgcaaacacaaaggggggcccaccccctgtgctgccggagcccggctacaacatt
aacaacaggattgcttcagaattaaaacttaagtga

DBGET integrated database retrieval system