KEGG   Cavia porcellus (domestic guinea pig): 100723547
Entry
100723547         CDS       T07777                                 
Symbol
Tnfrsf8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100723547 (Tnfrsf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cpoc04050]
    100723547 (Tnfrsf8)
   04090 CD molecules [BR:cpoc04090]
    100723547 (Tnfrsf8)
Cytokine receptors [BR:cpoc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100723547 (Tnfrsf8)
CD molecules [BR:cpoc04090]
 Proteins
  100723547 (Tnfrsf8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100723547
NCBI-ProteinID: XP_023421561
LinkDB
Position
Unknown
AA seq 720 aa
MAQMVTRPVPHGSAEFRFPAVTPPPRCPTGAPVCRPPPPGPLSLVIQPPTRHPAEPGSRR
DSGRTDAAPAPTSSVLRGKPSPQVTTISDGGGSLAEDPQGGTAQSGAISSVVGKGHRESA
VGIRRHRGQGTSPPPLPTEALGAEIGIRALAFDPEVFKASGRVPGSRSGERCTSGRPVGE
RPRLTREEAAPWAVTLAGSELQAGWGTLRCARARACPPPGMRALRAALALSLLGTLRAFP
QDRALAPTCTGDPSRYYDRATGQCCYRCLPGSLPAQSCPQGPSDCRKKQCDPEHYVDESG
YCLACVSCFGDLVEKVPCSWNSSRMCECRPGMFCKTSAAYSCARCQPHSPCSEGKVITAL
GTAERDTVCDWPSPGTSLDCASPEACRIPTRGATRQAKPTEVSPATADARTPPQGGDTPP
RLEDAPQLRPTAVPGSPFSVAELGLHPGVVGGDTTLEPPALETHPGYSPPANSKAPASTR
PTQSPLMGSPTSLGPPVSTSTRGSLPSTGRPILDPGPVLFWVIMVLAVVLGSGSFVLCYR
RACRARIRQKLHLCYPTQTVRPGLEPADSRARRNLMWPRSDVPGTEPGTEALSVAGPQVV
ETCANVGAASPENLLLLDASPAGDEVSPRDPPEPRVSTEHTNNRIEKIYIMKADTVIVGS
VKTELPEGRGPAVPELETDLEVDQASHYPEQETEPPLDSCGDVMFSVEEEGKEDPWLSAK
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcgcagatggtgacgcggccggtgccgcatggctcggctgagtttcgtttcccagca
gtgacccctcccccacggtgccccacaggagccccagtctgccgcccgccacccccaggg
cccttgtccctggtcattcagccacccacgcgacacccagccgagcccgggtcacgccgg
gacagcggcaggacagatgcagctcctgctcccacgagctccgtccttcgaggaaaacca
agccctcaggtgaccacaatttcagatggaggtgggtccctggcagaggacccgcagggt
ggcacggcccaaagtggtgccatcagcagtgtggtcgggaaaggccacagggaaagtgcc
gtgggaatcaggaggcaccgaggccaagggacgagccctcccccgctccccacagaggct
ctgggggctgagattggcatcagggccttggcctttgacccggaagtattcaaagccagc
ggccgcgttcctggaagccgctctggggagcggtgcacctcgggacggccggtgggggag
aggccaaggctgacccgggaagaggctgccccttgggcagtgacgctggcggggagcgag
ctgcaggccggctggggcaccctccgctgcgcacgtgcgcgcgcctgcccacctcccggg
atgcgcgccctccgagccgccctggcgctgtcgctcctggggaccctgcgagccttcccg
caggatcgagccctggctcccacctgcaccggagaccccagccgatactacgacagggct
acggggcaatgctgctaccgctgcctcccagggtcgttgccagcacagtcctgtcctcag
gggccttccgactgcaggaagaagcagtgtgatcccgagcactatgtagatgagagcggc
tactgcctggcctgtgtgagctgcttcggagacctcgtggagaaggtgccgtgctcctgg
aactcctcccgcatgtgcgagtgccggcccggcatgttctgcaagacctcggccgcctac
tcctgtgcccgatgccagccgcactccccctgctccgagggcaaggtcatcacggccctg
ggcacagctgagagggacacagtgtgtgactggccttccccagggaccagtcttgactgc
gccagcccagaggcctgcaggatccccaccaggggtgccacccgccaggccaagccaact
gaagtgtccccagccactgccgatgccaggaccccgccccagggaggggacactccgccc
aggctggaagatgctccccagctgcgacccacagcagttcccgggtctcccttctctgtg
gcagagttgggcctgcatccaggtgttgtcggtggggacaccaccttggagccacctgcc
ctggaaacccaccctggttacagcccaccagccaacagcaaggctcctgccagcacacgc
cccacccagagccccctgatgggctcccccaccagcctcgggccccctgtctccaccagc
acccggggctccctgccctccacagggaggcccattctggatccaggacccgtgctcttc
tgggtgatcatggtgctggcggtggttctaggctccggctccttcgtcctgtgctaccgg
agggcctgcagggcgcgaattcgccagaagctgcacctgtgctacccgacccagaccgtc
cggcccgggctggagcctgccgattccagagctagaaggaacctgatgtggcccaggagt
gatgtgccggggacagagccagggacagaagcactgagtgtggcgggcccccaggttgtg
gagacctgtgccaacgtgggggcggccagccctgagaacctgctgctgctggatgccagc
cctgccggggacgaggtgtcccccagggatccccccgagccccgggtgtccacggagcac
accaataaccgcatcgagaaaatctacatcatgaaagccgacacagtgatcgtggggagc
gtcaagacggagctgcctgagggccggggccctgcggtgcctgagctggagacagacctg
gaggtggaccaagcgtcccactaccccgagcaggagacagagccgcccctggatagctgc
ggagacgtcatgttctcggtggaggaagaggggaaggaggacccctggctttctgcgaag
tga

DBGET integrated database retrieval system