KEGG   Cavia porcellus (domestic guinea pig): 100735416
Entry
100735416         CDS       T07777                                 
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
cpoc  Cavia porcellus (domestic guinea pig)
Pathway
cpoc04610  Complement and coagulation cascades
cpoc04810  Regulation of actin cytoskeleton
cpoc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cpoc00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100735416
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100735416
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100735416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cpoc04515]
    100735416
   04090 CD molecules [BR:cpoc04090]
    100735416
Cell adhesion molecules [BR:cpoc04515]
 Integrins
  Integrin alpha subunits
   100735416
CD molecules [BR:cpoc04090]
 Proteins
  100735416
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2 pAdhesive_8
Other DBs
NCBI-GeneID: 100735416
NCBI-ProteinID: XP_012997645
Ensembl: ENSCPOG00000015518
LinkDB
Position
Unknown
AA seq 1157 aa
MSRTCTILLLFTALAASLGFNLDTQQMTDFHVDSPGFGHSVVQYTNSRVMVGAPKEIKAT
NRTGGLYQCNYPTRRCEPVPLQVPPEAVNMSLGLSLAAATNPSQLLACGPTVHQACRQNM
YLMGLCFLLASPGQGSKKLPDSLQECPRQDHDIVFLIDGSGSITRIDFTKMKSFVKSVMS
QFQRPSTQVSLVQFSSRFQIHFTFKDFVSSSDPLGLVNSVSQLGGYTHTATAIRNVVNQL
FTTQNGARRDATKILIVITDGQKTGDALDYKDVIPMAEAAGIIRYAIGVGSAFQHLTSRN
ELNWIASGSSYIFKVENFDALKAIQNQLKEKIFAIEGTQMVSSSSFELEMSQEGFSAAFT
PDGPVLGAVGSFDWSGGAFLYPPNGSPTFINMSQEHVDMRDSYLGYATELALWKGVQSLV
LGAPRHQHIGKVIIFIHATRQWRPQAEVTGTQIGSYFGASLCSVDVDRDGITDLVLIGAP
HYYEPTQGGQVSVCPLPKGRARWRCDALLQGEQGHPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEENQGAVYVFHGVSGQGISWAHSQRVTGSQLLPGLQHFGQSLSGGQDLTLDGLVD
LAVGSQGHVLLLRTRPVLRVGVTMSFTRAEIPRSMFECQEQAASIQDLGDAIVCFDIYES
TKSRGGNLQSSVTFELTLDPGRLSPRATFKETNTRTLTRVQVFELSRHCETLQLLLRTCV
EDSVTPITLRLNFSLEGNPIPSLGGLQPVLASDARTYFTASLPFEKNCGDDHICQDDLAI
TFGFLGLKTLVVGSNLELNIEVTVSNDGEDSYGTTVTLFYPEGLSYLRVARQQNQQHLRS
LRLTCDSAPNGGQAAWSTYCSINHLILPGGTQHFFLLQPHTPSSSSVALSNQPFLISSEN
NTPRTSKTTFQLELPVKYAVYTVISSQEQSVKYLNFSASEEEGGSVAVHRYQVNNLGQRD
LPVTVNFWVPVGLNGIATWAEMEVSHPQNPSIQCSSEQLIPTEADFQTYLQKNPELDCSI
ADCLRFRCDVPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFNRSMYSQLPG
QEAFLRAQMKTMLEKYEIHNPIPLIVGSCVGGLLLLALITASLYKVGFFKRQYKEMMEEA
NGQLVPEYETQDPQVVQ
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgagcaggacctgcacaatcctcctgctgttcacagccttagctgcttctcttggcttc
aatctggacacacagcagatgacagacttccatgtggacagccctgggtttgggcacagc
gtggtccagtataccaactccagggtgatggttggagcccccaaagagatcaaggctaca
aatcggacaggtggcctctaccagtgtaactatcccacacgccgctgtgagcccgtcccc
ctgcaggtccccccagaggctgtgaatatgtccctaggcttgtccctggccgctgccacc
aacccttcccagctgctggcctgtggccctactgtgcaccaggcatgcagacagaacatg
tacttgatggggctgtgcttcctgttggcctctcctggacagggcagcaaaaagcttccg
gattctctgcaggagtgcccaaggcaggatcacgacatcgtgttcctgattgatggctct
ggcagcatcacccgcattgatttcaccaaaatgaaaagctttgtgaagtctgtgatgagc
cagttccagaggcccagcacccaggtttctctggtgcagttctccagccgattccagata
cacttcactttcaaagactttgtctccagctcagatcctctagggctggtgaactctgtg
agccaactaggaggatacactcacacagccacggccatcagaaatgtcgtaaatcaacta
tttaccacccaaaatggagcccgcagggatgccactaagatcctgattgtcatcactgat
gggcagaaaacaggcgatgctctggattataaggatgtcatccctatggctgaggcagca
ggcatcatccgctatgcaattggggttggttcagcttttcagcatttgacttcccggaat
gaactgaactggattgcatcgggttcctcatacatatttaaagtggagaactttgatgct
ttgaaggctattcaaaaccagctgaaggagaagatctttgccattgagggtacacagatg
gtaagcagtagttcttttgaactggagatgtcccaggagggcttcagcgctgcattcacc
cctgatggaccagttctgggggctgtgggaagcttcgactggtctggaggtgccttcctg
tatccccctaatgggagtcccacattcatcaacatgtctcaggagcacgtggacatgagg
gactcttacctgggttacgccactgaactggccctttggaagggggtgcagagcctggtc
ctgggggcccctcgccatcagcacatcgggaaggttatcatcttcatccatgcaaccagg
cagtggaggccacaagctgaggtcacagggacccagattggctcctactttggggcctcc
ctctgctctgtggatgtggacagagatggcatcactgacctggtcctcattggggcccct
cattactacgagccgacccaaggaggccaggtgtccgtgtgtcccctgcccaaggggagg
gctcggtggcgatgtgacgctcttctccaaggtgagcagggccatccctggggccgcttt
ggggcagccctgacagtgctgggggacgtgaatggggacaagctgacagacgtggccatc
ggggcccctggagaggaggagaaccagggtgctgtctacgtgtttcatggagtctcaggc
cagggcatcagctgggcccatagccagagggtcacaggctcccagcttttgcctgggctc
cagcactttgggcagtctctcagcggaggccaggacctcaccctggatggactggtggat
ctggccgtggggtcccagggacacgtgctactgctcaggacaagacctgtcctcagggta
ggagtaaccatgagcttcacacgtgcagagatccccaggtctatgtttgagtgtcaggag
caggcagcctctatccaggacctgggtgatgccattgtctgctttgatatttatgaaagt
accaagagccgaggaggtaacctccagagctctgtgacctttgaacttacccttgatcct
ggccgcctgagtccccgtgccaccttcaaggagacaaatacccggactctgactcgagtc
caagtctttgagctgagccggcactgtgagactttgcagttgcttctacggacctgtgtg
gaggactcagtgacccccattactttgcgcctcaacttctctctggagggcaatcccatc
ccttccctcggagggctccaacctgtgctggcttcagatgctcggacgtacttcacagcc
tctctcccctttgagaagaactgtggagatgaccacatctgccaggatgaccttgccatc
acctttggcttcttgggcttgaagacattggtggtggggagcaacctggaactgaacatt
gaagtgacagtgtccaatgatggtgaagactcttacggaaccacagttaccctcttctac
ccagaagggctgtcctatctacgtgtggcaagacaacagaaccagcagcaccttcgctcc
ctgagactgacgtgtgacagcgcccccaatgggggccaggctgcttggagcacctactgc
agcatcaaccacctcatcctccctgggggcacacagcattttttcctcctgcagcctcac
actccatcctcctcctctgtggcccttagcaaccagcctttcctcatttccagtgagaat
aacacgcccagaaccagcaaaaccaccttccagctagagctcccggtgaagtacgctgtc
tacactgtaatcagcagccaggagcagtcagtcaagtacctcaacttctcagcttcagaa
gaggaaggaggcagtgtggccgtacacagataccaggtgaataacctgggtcagagggac
ttgcctgtcaccgtcaacttctgggtgcctgtggggctgaatggaatagctacatgggca
gagatggaggtctcccacccccagaacccatccatccagtgctcctcagagcaactgatt
cccacagaggctgacttccagacttacctgcagaagaatcctgagctggactgctccatc
gccgactgcctaaggtttcgctgcgacgtcccctcatttggcatccaggaggagcttgac
ttcatcctgaagggcaacctcagctttggctgggtcagccagacgctgcagaagaaggtg
ttggttgtcagcgtggctgaaatcacgttcaacagatccatgtattcccagctgccaggg
caggaggcatttctgagagcccagatgaagacaatgctggagaagtatgagatccataac
cccatccccctcatcgtgggtagctgcgtgggaggtctgctgctgctggctctcatcacg
gcctcactatacaaggttggcttcttcaaacgtcaatataaggaaatgatggaggaggca
aatggacagcttgttccagaatatgagacacaggacccccaggtggtccaatga

DBGET integrated database retrieval system