KEGG   Crocodylus porosus (Australian saltwater crocodile): 109305765
Entry
109305765         CDS       T07440                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
cpoo  Crocodylus porosus (Australian saltwater crocodile)
SSDB
Motif
Pfam: MRAP EVC2_like
Other DBs
NCBI-GeneID: 109305765
NCBI-ProteinID: XP_019384369
LinkDB
Position
Unknown
AA seq 85 aa
MANKTNSSEYYWSYEYYWDYFDPFPVDGRMLKVHKYSIVIAFWVGLATFLMFLFLILLYM
SRSGSTPVKQVAINNREEENSSSGD
NT seq 258 nt   +upstreamnt  +downstreamnt
atggctaacaaaacaaactcatctgagtattactggtcttatgaatattattgggactat
tttgatccatttccagtagatggaaggatgctgaaggttcataaatattcaattgtcata
gccttttgggttggacttgctacattcttgatgtttctcttcctcattttgctctacatg
tccagatctggatccacaccagtaaaacaggtggctataaataaccgggaagaagaaaac
agctccagtggtgactga

DBGET integrated database retrieval system