KEGG   Crocodylus porosus (Australian saltwater crocodile): 109314496
Entry
109314496         CDS       T07440                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
cpoo  Crocodylus porosus (Australian saltwater crocodile)
Pathway
cpoo04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cpoo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109314496 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cpoo04050]
    109314496 (TNFRSF8)
   04090 CD molecules [BR:cpoo04090]
    109314496 (TNFRSF8)
Cytokine receptors [BR:cpoo04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109314496 (TNFRSF8)
CD molecules [BR:cpoo04090]
 Proteins
  109314496 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 Epiglycanin_C
Other DBs
NCBI-GeneID: 109314496
NCBI-ProteinID: XP_019397254
LinkDB
Position
Unknown
AA seq 607 aa
MCEQYKQARIRYFVVWAENITVKPKASEFWQEKPCSLRDCSMCKPEECPGGPKIPDFLPQ
LEHLSVSGFSNTDSPPLGTPDFKSYDSLPVVDDIGKTTLLFKAGSCPVKTIDSQAYLLAS
GLLAKSCDKLNNQFYDEASKKCCYHCPTGSIKQAPCPTNLDKDCRWCEPEQYLKEAHPKP
RCEACVSCMTEHDLVEKAPCTFNSSRVCECRAGFFCKMSVLNTCARCDRHTSCYPGYGVK
VRGTSKTDVICQVCPPGTFSDRFSSTETCRPHTDCAKLSKVAMTKGNNTHDQVCKDPSPN
VLSRVPTLATFRNSTQGTDPAGVPSQHTHLEHPVDSRRATHPSLLLSDVTSGNVHPTGGT
AGGADTKPAAGTFLTSGVATDKTVKEENGNFIPWVMVVLPVMVLLGAMGVFWQKKFCKRR
IFTLIRKTAPNVYQVPIQQPRPGSQGPDLMKTCARRISMLKAEKGPEERELITSSPNMET
NNNSPSSTEKTHGPELNLAEVNQSSGNSLDCPVDARVRDHTNNRIEKIYIMKADTVIVGS
ISEVSGGKNCAVRGYDSDAEAQENPVETDGAMHYPEQETESFPGSDVMIPVEEEGKEFHH
PTTATEK
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtgtgagcagtacaaacaggcgcgaatccggtactttgtggtttgggctgaaaacatc
acggtgaaaccaaaggccagtgagttctggcaggagaagccctgctccttgcgagactgc
agcatgtgcaagcccgaggagtgccccggtggccccaagatacccgacttcctgccccaa
ctggagcatctctcggtctcggggttcagcaatactgactccccacctctgggcacccct
gacttcaaatcctacgacagtctccctgtggtggatgatattggcaagactaccctgctc
ttcaaggcaggttcttgccctgttaaaacaattgactcccaagcctacctcctggcatcg
gggctcttggccaagtcctgtgacaagcttaataaccagttctacgatgaagcttcaaaa
aaatgctgctaccactgtcccacaggctccattaaacaggcaccatgccctactaacttg
gacaaggactgcaggtggtgcgagcccgagcagtacctgaaggaggcacatccaaagccg
cgttgtgaggcctgcgtgtcatgcatgacagaacatgaccttgtggagaaagccccctgc
accttcaattccagcagggtgtgtgagtgccgggcaggattcttctgtaaaatgtcagtc
ctgaacacttgtgcacgttgcgaccgtcacaccagctgctatcctgggtatggagtcaag
gtcagaggcacctccaaaacagatgtcatctgccaagtgtgtcctccaggcaccttctct
gaccggttttccagcacagaaacctgcaggcctcacacagactgtgccaagctgagcaag
gtagcgatgaccaaaggaaacaacacccatgaccaagtatgcaaggacccatctcccaac
gtcctcagtcgggtccctacacttgcaacatttagaaacagtacccagggtactgaccca
gctggggtgccctcccaacacacccatcttgagcatcctgttgactccagacgggcaaca
caccccagcctcctcctgagcgatgtgacctctggcaatgtccacccaactggaggaact
gccggtggagcagatacaaagccagctgctggcactttcctgacctcaggtgtagccaca
gacaagactgtgaaggaagagaatggcaacttcattccctgggtcatggtggtcctccca
gtgatggtgttgcttggggccatgggagtgttttggcaaaagaagttttgcaagcgacgg
atcttcaccctcataaggaagacagctcctaatgtgtaccaagtccctatacaacaaccc
aggcctggatctcaagggcccgatttgatgaagacttgtgcaaggagaatcagtatgttg
aaagctgaaaaggggccagaagagagggagctaattaccagcagccccaacatggaaacc
aacaacaactcaccttccagcacagagaaaacccatgggcctgagctgaatctggccgag
gtgaaccagagcagcggaaattccctagattgcccggtcgacgctcgtgtgagggaccac
actaataaccggatcgagaaaatttacatcatgaaagcagacacagtgattgtgggctcc
atctcggaagtgtccggaggcaagaactgtgccgttcgagggtatgacagtgatgctgag
gcccaagaaaacccagtggaaacggatggggcaatgcactatccagagcaggagacagaa
tcattcccaggaagcgatgtcatgattcccgtggaggaggaagggaaggaattccatcac
cccaccactgccaccgagaagtga

DBGET integrated database retrieval system