KEGG   Chenopodium quinoa (quinoa): 110692719
Entry
110692719         CDS       T05764                                 
Name
(RefSeq) anthocyanidin 3-O-glucosyltransferase 2-like
  KO
K15775  betanidin 6-O-glucosyltransferase [EC:2.4.1.-]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00965  Betalain biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    110692719
Enzymes [BR:cqi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     110692719
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 110692719
NCBI-ProteinID: XP_021725454
LinkDB
Position
Unknown
AA seq 483 aa
MELVLVPTPGMGHLLSAVELAKRILDRDHRISILILIFNNIPMSSQTLNSFVDSQSRDNA
HPTRLTFYSLPPLSNPPDPTSPNFFQTLISLHKPLVKTAVEDKVKAGSLAGFVLDMFCTT
MIDVADHFMVPSYIFFTSGASMLNLLFHFFMLEDDQGVDIAAKLNDPDIEFDAAGFVNRV
PGKVVPEGLVSKEFGSFRFLDQFCEFKKSKGIIVNTFTELETFGVQSLFDQASKNGMPAF
YPVGPILELDTKHRGGHRVDDEESIIKWLDDQPSSSVVFLCFGSMGSFDEEQVIEIANGL
EKSGHRFLWSLRKPPPEGKLGLPSENETFEEALPEGFPDRTAERGKIIGWAPQVSILGHK
ALGGFVSHCGWNSTLESLWFGVPMATWPLYAEQQLNAFELVKELGLAVEIRIDYRRDWKT
RKGNFKVTAEEIENGVNKLMSLDEETKNKVREISDKSRNALEDGGSSHKRLGQFIEDVLS
NVA
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggagctggtgcttgtaccaacaccaggaatgggccaccttctctccgccgtagaatta
gccaaacgcatcctcgaccgcgaccaccgcatatcgatcctcatcctcatcttcaacaac
atccccatgagttcccaaacgctcaactccttcgtcgattcccaatcacgtgacaatgct
caccctactcgcctcaccttctattctttaccacccctttccaaccctcctgaccccacc
tcccccaacttctttcaaacactcatcagcctccataaaccactcgttaaaactgctgtc
gaggacaaagtcaaggccggcagccttgccgggtttgtcctcgacatgttttgcactacc
atgattgatgttgctgatcacttcatggtcccctcgtatattttcttcacttccggagct
agtatgttaaatcttttatttcacttctttatgttggaagatgatcaaggggttgacatc
gctgctaaactcaacgacccggatatcgagttcgatgcagccggattcgttaaccgggtc
cccgggaaagtcgtccctgaagggttagtcagcaaggaatttgggtctttcaggtttctt
gatcaattttgtgagtttaaaaaatccaagggtataatagtaaatacgttcactgagctt
gaaacgtttggtgtacagtctttgttcgatcaagcgagtaagaatggtatgccggcattt
tatcctgtgggtcccatcttggagctcgatactaagcaccggggtgggcaccgagttgat
gatgaggagtccattataaaatggctagatgatcaaccttcatcttcggtagtgtttctc
tgcttcgggagcatgggaagcttcgatgaggaacaagtgatagagatagctaacggccta
gagaagtccggacatcggttcttgtggtccttacgaaaaccaccacccgagggtaaactt
ggacttccaagtgagaacgaaacatttgaggaagcattacctgagggctttccagaccgc
acggctgaaagagggaaaattatagggtgggcaccacaagtctcgatcctaggccataag
gccttaggagggttcgtgtcacattgtggttggaactcgacattggagagtttgtggttt
ggggtgcctatggctacatggccgttgtacgcggagcaacaattgaacgcgtttgagcta
gtgaaggagcttggactagcagtggagattaggattgattatcgacgtgattggaagact
aggaaaggtaactttaaggtgaccgcggaggagattgagaatggggtgaacaagttgatg
agtttggatgaggagacgaagaacaaagtaagggaaattagtgacaaaagtagaaatgca
ttagaagatggtggttcatctcataaaaggttgggtcaatttattgaagatgttttgagc
aacgttgcttaa

DBGET integrated database retrieval system