KEGG   Chenopodium quinoa (quinoa): 110718751
Entry
110718751         CDS       T05764                                 
Name
(RefSeq) scopoletin glucosyltransferase-like
  KO
K15774  betanidin 5-O-glucosyltransferase [EC:2.4.1.-]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00965  Betalain biosynthesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Module
cqi_M00961  Betacyanin biosynthesis, L-tyrosine => amaranthin
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    110718751
Enzymes [BR:cqi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     110718751
SSDB
Motif
Pfam: UDPGT 6PGD Cerato-platanin
Other DBs
NCBI-GeneID: 110718751
NCBI-ProteinID: XP_021753343
LinkDB
Position
Unknown
AA seq 488 aa
MGAEPEELHVVLFPFMAHGHMIPTLDIARLFAARDGVKATIITTPLNVAVFTKAIGSREK
IEAPTVNIEAFRFPAQEAGLPEGMENLEQVLGSELMSNFFKATEMLREQLEQYLEKFRPN
CLVSDMFFTWTTDLAARFNIPRLVFHGTSSFSLCAQEVIRLHEPFNNVSSDEETFVLPNF
PHEIQMTRLQISEELRSSEDSEYKRRTANFKESELESYGVIVNSFYELEPDYADFFRIEL
GRRAWNIGPVSLSNRSIEDKVQRGKQASIDEHECLKWLDSKKPDSVIYICFGSTASFIVP
QLHKIAMAVEASGQEFIWVIRNYSGKFEEWLPAGLEQRIAGKGLIIKGWAPQVLILEHEA
IGGFVTHCGWNSTLEGISAGVPMVTWPIFAEQFYNEKLVTHVLKTGVSVGAKKWSRTPSL
EYLIKQEAIEKALTEIMVGKEAEERRTRAKKLKEMAQKSVEEGGSSYLDLSALINELRDY
HLQTPDNR
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgggtgctgaacctgaagagcttcacgtagttctcttcccattcatggcacatggccat
atgattccaacccttgatatagcaagactctttgcagctcgtgatggtgtgaaggcaacc
attataactacccctctcaatgttgccgtcttcaccaaggccataggtagcagagagaaa
atcgaagccccaactgttaacattgaagccttcaggtttccggctcaggaagctggccta
cctgaagggatggaaaacttggagcaagtattaggttctgaattaatgagcaacttcttc
aaagctacagagatgctaagagagcaactcgagcagtacttggagaaattccgacctaac
tgccttgtgtctgacatgttcttcacatggacaactgaccttgcagctaggtttaacatc
ccgaggctagtcttccacgggacttcctccttttccctctgtgctcaagaagttattagg
ctacatgaaccctttaacaacgtgtcctctgacgaagaaacatttgttcttcccaatttt
ccccatgagatacagatgacaagattacagatctcagaggaattaaggagcagtgaggat
tcagaatacaaaaggaggacagctaatttcaaggaatcagagctcgagagttatggggtg
attgttaacagcttttatgaattggaaccagattatgcagactttttcagaatagaattg
ggaagaagggcatggaatataggccctgtttcactgagcaatagaagcatagaggataag
gttcagagaggcaagcaggcttcgatcgatgaacatgaatgcttgaaatggcttgactca
aagaagcctgattcggttatttacatctgtttcggaagcacggcaagcttcatagttcct
caactgcataagattgcaatggccgtagaagcctcaggacaagaattcatatgggtcata
aggaattacagcggaaaatttgaagagtggttgccagcaggactcgagcaacggatagca
gggaagggcttgattataaaggggtgggctccccaggtgttaattttggagcatgaagcc
attggaggttttgtaactcactgtggatggaattcaacactagaagggatctcagctggc
gtgccaatggttacctggcctattttcgccgagcaattctataatgaaaaattggtgact
catgttttaaagactggcgtctctgtaggagctaagaagtggagtaggacaccttcacta
gaatatctcatcaagcaggaagctatagagaaagcattgacagaaatcatggtgggaaaa
gaggcagaagagaggagaaccagagcaaagaagttgaaggaaatggcacagaagtctgtt
gaagaaggcggctcatcatacttggacttaagtgcattgataaatgagctaagagattat
cacctccagactccagacaacagataa

DBGET integrated database retrieval system