KEGG   Capsella rubella (pink shepherd's-purse): 17880239
Entry
17880239          CDS       T02984                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit, chloroplastic
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00660  C5-Branched dibasic acid metabolism
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    17880239
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17880239
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17880239
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     17880239
    4.2.1.35  (R)-2-methylmalate dehydratase
     17880239
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 17880239
NCBI-ProteinID: XP_006286000
UniProt: R0H5S4
LinkDB
Position
Unknown
AA seq 512 aa
MASSVISSSPFVCKSSSSLKKDLGFSSFTKSSQISIHRCQKKSISRKIVSVMAPQKDRSP
GTTGSVKTGMTMTEKILARAAEKSLVVPGDNIWVNVDVLMTHDVCGPGAFGIFKREFGEK
AKVWDPEKIVVIPDHYIFTTDKRANRNVDIMREHCKEQNIKYFYDITDLGNFKANPDYKG
VCHVALAQEGHCRPGEVLVGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKILLKVPPTM
RFILDGEMPSFLQAKDLILQIIGEISVAGATYKTMEFSGTTIESLSMEERMTLCNMVVEA
GGKNGVIPPDATTFDYVENRTSVPFEPVYSDGNASFVADYRIDVSKLEPVVAKPHSPDNR
ALARECKDVKIDRVYIGSCTGGKTEDFMAAAKLFHAAGRKVKVPTFLVPATQKVWMDVYA
LPVPGTGGKTCAQIFEEAGCDTPTSPSCGACLGGPADTYARLNEPQVCVSTTNRNFPGRM
GHKEGQIYLASPFTAAASALTGHVADPREFLQ
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcttcttctgttatctcttcttctcctttcgtctgcaaatcatcatcctccttaaag
aaggatttggggttttcttcgtttacgaaatcgtctcagatttcgattcatcgatgtcag
aagaaatcgatttctcggaagattgtttctgttatggctcctcaaaaggatcggtctcct
ggtaccacaggatcggtgaaaactgggatgacaatgacggagaagattctagctagggcg
gctgagaagtcgttagttgttcctggtgataatatttgggttaatgttgatgttcttatg
actcatgatgtttgtggacctggtgcttttggtatctttaagagagagtttggtgaaaag
gctaaggtttgggacccagagaagattgttgttattccagaccattacatattcactact
gataagcgtgcaaaccggaatgtagacattatgcgggaacattgcaaggaacagaacatc
aagtatttctatgatatcaccgaccttggaaattttaaggctaatcctgactacaaaggt
gtttgccatgtcgctcttgcacaagaaggtcattgcaggccaggagaggttttggtagga
acagattcacacacttgtactgctggagcatttggtcaatttgctacagggattggaaac
actgatgcaggctttgtgttaggcactggaaaaatcctccttaaggttccaccaacaatg
aggtttatcttggatggggaaatgcccagttttttgcaagcaaaggatctgattttgcaa
attattggtgaaatttctgttgccggtgcaacttacaagacgatggagttcagtggtaca
actatcgaaagtctgagtatggaagaaagaatgacattgtgcaacatggttgtggaagct
gggggaaagaatggtgtcatcccacctgatgcgacgacatttgattatgttgagaatagg
acatctgtaccgtttgagccagtatacagtgatggaaatgcaagctttgtcgcagattat
agaattgatgtgtcaaagctggagcctgtggtagctaagcctcattctcctgacaaccgg
gctctagcaagagaatgcaaagatgtgaaaattgacagagtatacattggttcttgtact
ggtgggaaaacagaggattttatggctgcagctaaacttttccacgctgcaggaaggaag
gtcaaagtcccaactttccttgtcccagctactcaaaaggtttggatggatgtgtatgct
ctccctgtgcctgggacaggtggaaagacatgtgcacagatctttgaagaagctggctgt
gacacaccaaccagtcctagctgtggtgcctgccttggtggcccagcagacacatacgct
cgcttaaatgaaccacaagtgtgtgtctcaaccacgaacaggaacttccccggtcggatg
ggacacaaagaagggcagatttacttagcttctccattcacagctgcagcctcggcctta
accggccatgtagctgacccaagggagttcttgcagtag

KEGG   Capsella rubella (pink shepherd's-purse): 17889552
Entry
17889552          CDS       T02984                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00660  C5-Branched dibasic acid metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    17889552
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17889552
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     17889552
    4.2.1.35  (R)-2-methylmalate dehydratase
     17889552
SSDB
Motif
Pfam: Aconitase_C
Other DBs
NCBI-GeneID: 17889552
NCBI-ProteinID: XP_006294858
UniProt: R0FYB2
LinkDB
Position
Unknown
AA seq 251 aa
MAASLQFGNPTLSRNLSSPNNSSSFAPFRSPFLRFNSTSVASDFKPLVSRNASSSFVTRS
AAEPQERKTFHGLCYVVGDNIDTDQIIPAEFLTLVPSNPDEYEKLGSYALIGLPAAYKER
FVEPGEMKTKYSIIIGGENFGCGSSREHAPVCLGAAGAKAVVAQSYARIFFRNSVATGEV
YPLDSEVRVCDECKTGDVATVELREGDSILINHTTGKEYKLKPIGDAGPVIDAGGIFAYA
RKAGMIPSAAA
NT seq 756 nt   +upstreamnt  +downstreamnt
atggcggcttctctgcaatttggaaaccctacattgtcccgaaacctatcttctccaaac
aactcttcctctttcgctcccttccgatctccatttctcagattcaattccacctccgtc
gcttccgatttcaaacccctcgtttcgagaaatgcatcctcatccttcgtcactcgctca
gccgccgagcctcaagagagaaagaccttccacggcctttgctacgtcgtcggtgataac
atcgacactgaccaaatcattcccgcagagtttctcactctcgtcccttcgaatccagac
gagtacgagaaactcggttcctacgctttaattggtctcccagctgcttacaaggagcga
ttcgttgagcctggtgagatgaagacgaagtactcgatcatcatcggcggtgaaaacttc
ggatgtggatcgtcacgtgaacacgctccggtctgtcttggtgcggcgggagctaaagca
gtggtggctcagtcttacgctagaatctttttcaggaactctgtggctacgggtgaggta
tatcctctggattcggaagttagggtttgtgatgagtgtaaaacaggggatgttgcgacg
gttgagttgagggaaggtgatagtattctgatcaatcatacgacggggaaagagtataag
ctgaagcctattggtgatgctggacctgtcattgatgctggaggcatatttgcttatgct
aggaaagctgggatgattccttctgctgctgcctga

DBGET integrated database retrieval system