KEGG   Capsella rubella (pink shepherd's-purse): 17881944
Entry
17881944          CDS       T02984                                 
Name
(RefSeq) acetolactate synthase small subunit 1, chloroplastic
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00650  Butanoate metabolism
crb00660  C5-Branched dibasic acid metabolism
crb00770  Pantothenate and CoA biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    17881944
   00660 C5-Branched dibasic acid metabolism
    17881944
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17881944
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17881944
Enzymes [BR:crb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     17881944
SSDB
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 NikR_C
Other DBs
NCBI-GeneID: 17881944
NCBI-ProteinID: XP_006286862
UniProt: R0H4V7
LinkDB
Position
Unknown
AA seq 476 aa
MAATATAASLYASRVHFQNQNKAHGFPAKTPNSVQVTQIIDGRKTRNVTVLAAASTDKAV
TAAQSVAPKASDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTI
VVLGTDKVLQQVVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIF
RAKIVDTSEHSLTIEVTGDPGKLVALETNLEKFGIREIARTGKIALRREKMGDTAPFWRF
SAASYPHHIQESHENVAEQRKLALTGNGNASSGGDVYPVEPYHDFKPVLDAHWGMVYDED
SSGIRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDH
IDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLDIAQVFRAKAIDVS
DHTITLEVTGDLRKMAALQTQLEVYGLCEVARTGRVALVRESGVDSTYLRGYSLPL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggccgccacggcgacggctgcatcattgtacgcatctcgtgtccacttccagaatcag
aacaaagctcatggctttcctgcaaagacccccaactcagtgcaagtaactcagatcatc
gatgggaggaagacgaggaatgtcactgttctcgccgctgcttccactgataaagccgtc
acagctgctcagtctgtagctccgaaggctagtgatagagtaaggaggcatacaatctcg
gtgtttgtgggtgatgagagcggtataataaaccggatagctggagtgtttgctagaagg
gggtataatattgagtcccttgccgtgggattgaatgaagacaaggctctgtttactatt
gttgttcttgggacagacaaagtcctccaacaagtcgtggaacagcttaacaaactcgtc
aatgtcatcaaggtggaagatctctccaaggagccgcatgtagaacgtgaactaatgctc
attaaacttaatgctgatccaagcactcgctcagagatcatgtggttggtggatatcttt
agagcaaaaatcgtggatacctcggagcactctctaacaattgaggtaactggagaccca
ggaaaattggttgcacttgagacaaacttggagaagtttggaataagagaaattgcgaga
acagggaagattgctctgagacgggaaaagatgggagacactgctccgttctggagattt
tcagcggcatcatacccacatcatattcaggagtctcatgaaaatgttgcagagcaaaga
aagctagcattgactggaaatggcaatgcatcatcggggggtgacgtttatccagtggag
ccctatcatgatttcaaaccggtccttgacgctcattggggaatggtctatgacgaagat
tcaagcggaatccgctcccacacgttatctatacttgtagccaacgtacccggagttctc
aatctaataaccggagctatctctaggagaggttacaacatccagagtctagctgttggt
cctgctgagaaagaaggcttatctcggattacaacagttatccctggaactgatgatcat
attgacaaattggttaggcagcttcagaagttgattgatcttcacgaggtccaaaatatt
acccacatgccatttgcggagcgagaactgatgctcatcaaagtagctgctcatacttct
gcgaggagagatgttctagatattgctcaagttttccgtgctaaagccattgatgtctct
gatcatactatcactcttgaggttacgggggatctcagaaaaatggctgcactacaaacg
cagttagaggtctatggactctgtgaggtggctcggactggaagagtggcattggtaaga
gaatctggagtggattcgacttatctccgtggatactctcttcctttgtag

KEGG   Capsella rubella (pink shepherd's-purse): 17887103
Entry
17887103          CDS       T02984                                 
Name
(RefSeq) acetolactate synthase, chloroplastic
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00650  Butanoate metabolism
crb00660  C5-Branched dibasic acid metabolism
crb00770  Pantothenate and CoA biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    17887103
   00660 C5-Branched dibasic acid metabolism
    17887103
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17887103
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17887103
Enzymes [BR:crb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     17887103
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 17887103
NCBI-ProteinID: XP_006293107
UniProt: R0HLB6
LinkDB
Position
Unknown
AA seq 667 aa
MAAAATTSSSISFSAKPSHPSSSKSPLPISRFTLPFSPNPNKSSSSSRRRGIKSSSLSIS
AVLNTTTNVSTTSPPKEPTKTEKFVSRFAPDQPRKGADILVEALERQGVETVFAYPGGAS
MEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADAL
LDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIVQEAFFLAT
SGRPGPVLIDIPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPEESHLEQIVRLISEAKKPV
LYVGGGCLNSSDELVRFVELTGIPVASTLMGLGSYPCDAELSLHMLGMHGTVYANYSVEH
SDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDIKLALQGMN
KVLENRAEELKLDFGVWRNELNEQKQKFPLSFKTFGEAIPPQYAIQVLDELTDGKAIIST
GVGQHQMWAAQFYKYKKPRQWLSSAGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFMM
NLQELATIRVENLPVKILLLNNQHLGMVMQWEDRFYKANRAHTYLGNPAKEGEIFPNMLE
FASGCGIPAARVTKIAELREAIQKMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITE
GDGRTKY
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggcggcggcggcaacaacatcatcttcgatctcattctcagcaaaaccttctcatcct
tcctcctccaaatcgccattaccaatctccagattcaccctcccattttccccaaaccct
aacaaatcatcatcctcctcccgccgccgcggtatcaaatcaagctctctctccatctcc
gccgtgctcaacacaaccaccaatgtctcaaccacttcgcctcctaaagaacccaccaaa
accgaaaaattcgtctcccgatttgctcctgatcaaccacgcaaaggcgctgatatcctc
gtcgaggccttagaacgtcaaggcgtagaaaccgtattcgcttatccaggtggtgcatca
atggagattcaccaagccttgactcgttcctcctcgatccgtaacgttcttcctcgtcac
gaacaaggaggtgtatttgcagctgaaggttacgctagatcctcaggtaaaccaggtatc
tgtatagccacttcaggtcccggagctacgaatctcgttagcggattagccgatgcgttg
ttagatagtgttcctcttgtagcaatcacaggacaggtccctcgtaggatgattggtact
gatgcgtttcaagaaactcccattgttgaggttacgcgttcgattacgaaacataactat
cttgtgatggatgttgaagatattcctaggattgttcaggaagctttctttttagctacc
tctggtagacctggacctgttttgattgatattcctaaagatatccagcaacagcttgcg
attcctaattgggaacaggctatgagattacctggttatatgtctaggatgcctaaacct
ccggaagagtctcatttggagcagattgttaggttaatttctgaagctaagaagcctgtc
ttgtatgttggtggtggttgtttgaattcgagtgatgaactggttagatttgttgagctt
acgggtatccctgttgcgagtacattgatgggtcttggttcctatccttgtgatgccgag
ttgtcgctgcatatgcttggaatgcacgggacggtgtatgctaattactctgtggagcat
agtgatctgttattggcttttggggtgaggtttgatgatcgtgtcacgggtaagcttgag
gcttttgctagtagggcgaagattgttcatattgatattgactcggctgagattgggaag
aacaagactcctcatgtgtctgtgtgtggagatattaagctggctttgcaagggatgaac
aaggttcttgagaaccgagcagaagaacttaagcttgatttcggagtttggagaaatgag
ttgaacgaacagaaacagaagttccctcttagcttcaagacgtttggggaagccattcct
ccacagtacgcgattcaggtccttgatgagctgactgatgggaaagccattataagcact
ggtgtcgggcaacatcaaatgtgggctgcgcagttctacaagtacaaaaaaccaaggcaa
tggctatcatcagcaggccttggagctatgggttttggacttccagctgctattggagcg
tcagttgcaaaccctgatgcgattgttgtagatattgacggagatggaagcttcatgatg
aatttgcaagagctggccacaatccgggtagagaatctcccagtgaagatacttttacta
aacaaccagcatcttggcatggttatgcaatgggaagatcggttctacaaagctaaccga
gctcacacatatcttggtaacccggcaaaggagggcgagatattcccgaacatgctggag
tttgcatcaggttgcgggattccagcagcgagggtgacaaagatagcagagctccgagaa
gctattcagaaaatgctggataccccaggaccatacttgttggatgtgatttgtccgcac
caagaacatgtgttgccgatgatcccaagtggtggcactttcaacgatgtcataacggaa
ggagatggccggactaaatactga

KEGG   Capsella rubella (pink shepherd's-purse): 17888744
Entry
17888744          CDS       T02984                                 
Name
(RefSeq) acetolactate synthase small subunit 2, chloroplastic isoform X2
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00650  Butanoate metabolism
crb00660  C5-Branched dibasic acid metabolism
crb00770  Pantothenate and CoA biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    17888744
   00660 C5-Branched dibasic acid metabolism
    17888744
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17888744
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17888744
Enzymes [BR:crb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     17888744
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4
Other DBs
NCBI-GeneID: 17888744
NCBI-ProteinID: XP_006294093
UniProt: R0FWJ5
LinkDB
Position
Unknown
AA seq 492 aa
MAAISVSSSPSLRCLRSACSDSPPALVSTTTRVSFAAKISYLSGNSSNRGEEMGKRMEGI
VRSVDGKISDASFPEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAV
GLNRDKALFTIVVCGTERVLQQVIEQLLKLVNVLKVEDISSEPQVERELMLVKVNANPES
RAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLEKFQIREIVRTGKIALRRE
KMGATAPFWRFSAASYPDLKKQAPVSVLRGSKKEATVPQNITTAGGDVYPVEPPSDHMIH
HVLDAHWGLLTDEDTSGLRSHTLSLLVSDVPGVLNIVTGVFARRGYNIQSLAVGHAETKG
ISRITLVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVL
DIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARESGVDS
KYLRGYSFPLTG
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcggccatttccgttagttcttcaccatctcttcgctgcttgagatctgcatgttcc
gattctcctcctgctcttgtgtccacgacgacgcgtgtatccttcgcggcgaagatttca
tatctgtcaggtaattcttcgaaccgtggcgaagaaatgggtaagagaatggagggaatc
gttagaagcgtcgatgggaagatctctgatgcatcttttcccgaagcttcatctgcgact
cctaaatcgaaggtgaggaagcacacaatttcagtgtttgttggagatgaaagcggaatg
attaacaggattgcaggagtctttgcgaggagaggatacaatattgagagtcttgctgtt
ggtctgaacagagacaaggctctattcaccattgttgtttgtggaactgaaagggtactt
cagcaggtcatcgagcagctcctgaagctcgttaatgttctaaaggttgaagatatctca
agtgagccgcaagtggagcgtgaactgatgcttgtaaaagtcaatgcaaatccagaatcc
agggcagagatcatgtggctagttgacacattcagggcaaaagttgtagacattgcagaa
catgcattgactattgaggtaactggagatcctggaaaaatgattgctgtagaaagaaat
ttggaaaagtttcagatcagagagattgtacggacaggaaagatagcactgagaagggaa
aagatgggtgcaactgctccattttggcgattttcagcagcatcctatccagatctcaag
aagcaagcacctgttagtgttcttcgaggtagcaaaaaagaagccacggtccctcaaaat
ataacaacagcaggaggagatgtttatcccgttgagccaccttctgaccacatgatacat
catgttctcgacgctcactggggacttctcactgatgaggacacgagcggactacggtcg
catactctatctttgcttgtgagtgatgttccaggagttcttaatattgtgactggtgtt
tttgctcgaaggggatacaatattcagagcttggctgtaggacatgctgaaaccaagggc
atttcacgcattacattagttgttcctgcaacagatgaatcggtcagcaaattggtgcag
caacttaataaacttgttgatgtgcatgaggtccatgatctgactcatttgccattttct
gaaagagaactgatgctgattaagattgccgtgaatgctgctgcgagaagagatgtacta
gacattgctagtattttcagggctaaagctgttgacgtatctgatcacactattactttg
cagcttactggggatttagacaagatggttgcgttgcagaggttgttggagccatacggt
atatgcgaggttgcaagaactggacgggttgcattggctcgtgaatcgggagtggactcc
aagtatcttcgtggatactcctttcctttaacaggctaa

DBGET integrated database retrieval system