KEGG   Capsella rubella (pink shepherd's-purse): 17884982
Entry
17884982          CDS       T02984                                 
Name
(RefSeq) ketol-acid reductoisomerase, chloroplastic
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17884982
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17884982
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     17884982
SSDB
Motif
Pfam: IlvC IlvN
Other DBs
NCBI-GeneID: 17884982
NCBI-ProteinID: XP_006290799
UniProt: R0FMJ6
LinkDB
Position
Unknown
AA seq 591 aa
MAAATSSIAPSLSCPSSSKTLRSSKARTLALPNIGFLSSSSKSLRSLTATVAGNGVGSAT
GSSLAARMVSSSAVKAPLALDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGVK
QIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARSAGFTEESGTLGDI
WETISGSDLVLLLISDAAQADNYEKIFAHMKPNSILGLSHGFLLGHLQSLGLDFPKNFSV
VAVCPKGMGPSVRRLYVQGKEINGAGINASFAVHQDVDGRAADVALGWSVALGSPFTFAT
TLEQEYRSDIFGERGILLGAVHGIVESLFRRYTENGMSEDLAYKNTVECITGTISRTIST
QGMLAVYNSLSEEGKKDFETAYSASFYPCMEILYECYEDVQSGSEIRSVVLAGRRFYEKE
GLPAFPMGNIDQTRMWKVGESVRKSRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSY
SEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDS
GAAINRDLISNFFSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSSN
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcggctgcgacttcatccatcgctccttccctttcatgtccatcttcatccaaaacc
ctaaggtcttccaaagctagaaccttggctctgcccaatattggtttcctttcatcttct
tccaagtcgctgaggtcgttaactgctaccgtcgctggaaatggtgtcggttccgccact
ggttcctcccttgccgctcgtatggtttcttcgtcagcggtcaaggcccctctcgcgctc
gacttcgagacatctgtcttcaaaaaggagaaagtatcccttgctggttacgaagagtac
attgtgagaggaggaagggatttattcaagcatcttccagatgctttcaagggggttaag
cagattggtgtgattggttggggatctcagggacctgcccaagctcagaatttgagagat
tcacttgtagaggcaaagtctgacattgttgttaagattggactcagaaaagggtctcgc
tcatttgaggaggcacgtagcgctggcttcactgaagaaagtggtactttgggtgatatc
tgggaaactatctctggcagcgatcttgtattgttgttgatctctgatgctgctcaggct
gataactatgagaaaatattcgctcacatgaagccaaatagcattcttggtttatcacac
gggtttctactagggcatttacagtccttgggacttgatttcccaaagaacttcagtgtg
gtcgctgtgtgccctaagggaatgggtccttctgtgaggaggctatacgtccaaggaaaa
gaaatcaacggtgctggaattaacgccagttttgcagtccaccaggatgttgatggtaga
gccgcagatgttgcactgggatggtctgtagctcttggttctccttttacttttgctact
actcttgaacaagagtacaggagtgacatctttggagaaagaggcatattgcttggtgct
gttcatggaattgtggagtccctatttagaaggtacaccgaaaatgggatgagcgaagac
ttggcttacaagaacacagtagaatgtatcacaggaacaatttcaaggactatctctacc
cagggaatgttggctgtgtacaactccttgtctgaagaaggtaaaaaagattttgagact
gcatacagcgcatccttctatccttgtatggagattctctatgaatgttacgaggatgta
caaagtggcagtgaaatccgaagtgttgtcttagccggtcgtcgcttctatgaaaaagaa
ggcttgccagcattcccaatgggaaatattgatcagacaagaatgtggaaggtgggtgaa
agcgtcaggaagtccagacccgccggtgacttgggtccactatatcccttcaccgctgga
gtttatgtagcacttatgatggctcagattgagatcttgagaaagaaaggtcactcttac
tcagaaattatcaacgagagtgtgatagaatctgtggactctctgaacccatttatgcac
gccaggggagtgtccttcatggttgacaactgctcgaccacagcgagattgggttcgagg
aaatgggccccacggtttgactacatcctgacccaacaagcgcttgtggctgtggacagt
ggtgcagcgatcaacagagacctgatcagcaacttcttctcagacccagtccatggtgcc
atagaggtctgcgcacagttgaggcctaccgttgatatctctgtgccagctgatgcagac
tttgttcgacctgagttgcgtcaatctagcaactaa

DBGET integrated database retrieval system