KEGG   Capsella rubella (pink shepherd's-purse): 17887394
Entry
17887394          CDS       T02984                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 3, chloroplastic
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00270  Cysteine and methionine metabolism
crb00280  Valine, leucine and isoleucine degradation
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
crb01240  Biosynthesis of cofactors
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17887394
   00280 Valine, leucine and isoleucine degradation
    17887394
   00290 Valine, leucine and isoleucine biosynthesis
    17887394
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17887394
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17887394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17887394
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     17887394
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class IV
   17887394
SSDB
Motif
Pfam: Aminotran_4 DUF3110 DUF4649 DUF4022
Other DBs
NCBI-GeneID: 17887394
NCBI-ProteinID: XP_006291199
UniProt: R0FNP8
LinkDB
Position
Unknown
AA seq 420 aa
MERAVISPGLNQNYLLFPSRAFSTRLHSFSSTRNLSPPSSSSLKLHHSSSSSSVLSSVIN
GGASFTRCNAVLSNSSSTEVSEIADIDWDNIGFGLKPTDYMYVMKCDIDGEFTKGELQRF
GNIEVSPSAGVLNYGQGLFEGLKAYRKEDGNSILLFRPEENANRLRNGAERMCMPAPTVE
QFVEAVKETVLANKRWVPPPGKGSLYVRPLLMGTGAVLGLAPAPEYTFIIYVSPVGNYFK
EGVSPINLIVENDFHRATPGGTGGVKTIGNYAAVLKAQSIAKAKGYSDVLYLDCVYKRFL
EEVSSCNIFIVKDNVISTPEIKGTILPGITRKSIIDVARTQGFQVEERNVTVDELLEADE
VFCTGTAVVVSPVGSVTYKGKRVSYGEGTFGTVSKQVYTVLTSLQMGLIEDNMNWTVNLS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggagagagcagtaatctcccctggtcttaatcaaaattacttacttttcccttcacgc
gccttctccacgcgcctccactctttctcctctactcggaacttatcgccgccgtcttcc
tcctccctcaagcttcatcattcttcgtcttcttcctctgtattgtccagtgtcatcaat
ggtggtgcctcctttactcgatgcaacgctgtgctctccaattcttccagtacggaggtg
tctgaaatagccgacatagattgggataacatcggattcgggcttaagccgactgattac
atgtatgtgatgaaatgtgacatcgatggagagttcacaaaaggtgaattgcaacgtttt
gggaacattgaagtcagcccatctgctggtgtgctcaactatggacagggattgtttgaa
gggctaaaagcttacagaaaggaagatggtaatagtatcctcctctttcgtcctgaggag
aatgcaaaccgtttgagaaatggtgcggagaggatgtgcatgcctgctccaaccgttgag
cagtttgtcgaagctgtgaaagaaactgtattagcaaacaaacgttgggttccacctcca
ggtaaaggttccttatatgttagaccgttgcttatggggacaggagctgttcttggtctt
gcacctgcaccagaatacactttcattatctacgtttcccctgttgggaactacttcaag
gaaggtgtgtcaccgatcaatttgattgtggaaaatgattttcaccgtgcaactcctggt
ggtaccggaggtgttaaaaccatcggcaattatgctgcagtactgaaggcacagtcgatt
gcaaaagctaaaggatattctgatgttctgtaccttgattgtgtttacaaacgatttctt
gaagaggtctcgtcttgcaatattttcatcgtaaaggataatgtgatctctactcctgaa
ataaaaggaaccattttacccgggattacacggaaaagtataatcgacgtggctcgaacc
caagggtttcaggtggaggaacggaatgtgacagtggatgagttactagaagcagacgag
gttttctgcacgggaaccgctgtggttgtctctcccgttggaagcgttacttacaaaggc
aaaagagtgtcttacggagaaggtacctttggaactgtgtcgaagcaagtgtacaccgtt
ctgacaagcttgcagatgggtctgattgaagacaacatgaactggactgtgaatctgagt
taa

KEGG   Capsella rubella (pink shepherd's-purse): 17887752
Entry
17887752          CDS       T02984                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00270  Cysteine and methionine metabolism
crb00280  Valine, leucine and isoleucine degradation
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
crb01240  Biosynthesis of cofactors
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17887752
   00280 Valine, leucine and isoleucine degradation
    17887752
   00290 Valine, leucine and isoleucine biosynthesis
    17887752
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17887752
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17887752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17887752
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     17887752
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class IV
   17887752
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 17887752
NCBI-ProteinID: XP_006294531
UniProt: R0HD28
LinkDB
Position
Unknown
AA seq 318 aa
MFTAKSSSEANFEQGYLSRYGNIELNPAAVILNYGQGIIEGMKAYRGEDGRVLLFRPELN
AMRMKIGAERMCMHSPSVQHFIEGVKQTVIANRRLVPPPGKGSLYLRPLLFGSGASLSVA
PALEYTFLVFGSPVQNYFKEGTAALNLYVEEVVPRAYIGGTGGIKAITNYSPVLEAMRSA
KSRGFSDVLYLDAETGKNIEEVSGSNIFLVKGNTIVTPATNGTILGGITRKSVIEIALDL
GYKVEERSVAVEELKEAREVFCTGTATGVASVGSITFQNTRTEYKVGDASVTQELRSVLV
GIQTGSIQDTKDWVLEIA
NT seq 957 nt   +upstreamnt  +downstreamnt
atgttcaccgccaaaagtagcagtgaagcaaacttcgaacagggttaccttagccgttac
ggcaacatcgagctaaaccctgctgctgtaattcttaactatggccagggaataattgag
gggatgaaagcgtacagaggagaagacggtagggttcttctcttccgtccagagctaaac
gcgatgcgtatgaagataggagctgagagaatgtgtatgcattctccttctgttcaacac
tttattgaaggtgttaagcagactgttattgcaaacaggcgtttggttcctcctcctgga
aaaggctctttgtatctcagaccgttgttgtttggaagtggagcaagcttgagtgtggct
ccagcactagagtacacgtttcttgtgtttggttctcctgttcaaaactatttcaaggaa
ggcacagcggcgttgaacctgtacgtggaggaggtggttccacgcgcctatattggtgga
actggtggcataaaagcaattacaaattacagtccagtacttgaggcgatgagaagcgcg
aaatcgagaggtttttcggatgttttgtatcttgatgcagagactgggaagaacatagaa
gaagtctctggttctaatatattccttgtgaaggggaatacaatagtgactccagctact
aacgggacaattctaggagggatcacgcgtaagagcgtcatcgaaatagcccttgatctt
ggttacaaggtggaagaacgaagcgttgccgtagaagaactgaaggaagcaagagaagtt
ttctgcactggaactgccactggggttgcttcagttggaagcatcacgtttcagaacaca
aggactgagtacaaagtgggagatgcgtctgttacacaggaacttcgatctgttctggtc
ggaatacaaactggctctatccaagacactaaggattgggttttggagattgcctaa

KEGG   Capsella rubella (pink shepherd's-purse): 17896929
Entry
17896929          CDS       T02984                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 1, mitochondrial isoform X2
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00270  Cysteine and methionine metabolism
crb00280  Valine, leucine and isoleucine degradation
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
crb01240  Biosynthesis of cofactors
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17896929
   00280 Valine, leucine and isoleucine degradation
    17896929
   00290 Valine, leucine and isoleucine biosynthesis
    17896929
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17896929
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17896929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17896929
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     17896929
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class IV
   17896929
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 17896929
NCBI-ProteinID: XP_006305870
UniProt: R0INP6
LinkDB
Position
Unknown
AA seq 381 aa
MALLRCIPQSSTYLPKIRGFRMHGTKAAASVVEEHISRAEREDEEYADVDWDNLGFSLVR
TDYMFATKSSSDGNFDQGYLSRYGNIELNPAAGILNYGQGLIEGLKAYRGEDGRVLLFRP
DLNAMRMKMGAERMCMHSPSVQHFIEGVKQTVLANRRWVPPPGKGSLYLRPLLFGSGASL
GVAAAPEYTFLVFGSPVQNYFKEGTAALNLYVEEVVPRAYLGGTGGVKAISNYGPVLEAM
RRAKSRGFSDVLYLDAETGKNIEEVSASNIFLVKGNTIVTPATNGTILGGITRKSVIEIA
LDLGYKVEERSVAVEELKDAREVFCTGTATGVASVGSITFQNTRTEYKVGDALVTQQLRS
ILVGIQTGSIQDTKDWVLEIA
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggctcttcttcgctgcatacctcaatcttcaacttatctccccaagatccgaggattc
cgaatgcatgggaccaaggcagcagcttctgttgtagaagaacatatctcgagggcagaa
cgtgaggatgaagagtatgctgatgttgactgggacaacctcggattcagtcttgtacgg
acagattacatgttcgccaccaaaagtagcagtgacggaaacttcgaccagggttacctt
agccgttacggcaacatcgagctaaaccctgctgctggaattcttaactatggccagggg
ctaatcgaagggttgaaagcgtacagaggagaagacggtagggttcttctcttccgtcca
gacctaaacgcgatgcgtatgaagatgggagctgagagaatgtgtatgcattctccttct
gttcaacactttattgaaggtgttaagcagaccgttcttgcaaacagacgttgggttcct
cctcctggaaaaggctcattgtatctcagaccgttgttgttcggaagcggagcaagcttg
ggtgtggctgcagcaccagagtacacgtttcttgtgtttggttctcctgttcaaaactac
tttaaggaaggcacagcggcgttgaatctgtacgtggaggaggtggttccacgagcctat
cttggtggaactggtggcgtaaaggcaatttcaaactacggtccagtacttgaggcgatg
agaagagcgaaatcaagagggttttcggatgttttgtatcttgatgcagaaactgggaag
aacatagaagaagtctctgcttctaatattttccttgtgaaggggaatacaatagtgact
ccagctactaacgggacaattctaggagggatcacgcgtaagagcgtcatcgaaatagcc
cttgatcttggctacaaggtggaagaacgaagcgttgccgtagaagaactgaaggatgca
agagaagttttctgcactggaactgccactggggttgcttcagttggaagcatcacgttt
cagaacacaaggactgagtacaaagtgggagatgcgcttgttacacaacaacttcgatct
attctggtcggaatacaaactggttctatccaagacactaaggattgggttttggagatt
gcctaa

KEGG   Capsella rubella (pink shepherd's-purse): 17897778
Entry
17897778          CDS       T02984                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 6
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00270  Cysteine and methionine metabolism
crb00280  Valine, leucine and isoleucine degradation
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
crb01240  Biosynthesis of cofactors
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17897778
   00280 Valine, leucine and isoleucine degradation
    17897778
   00290 Valine, leucine and isoleucine biosynthesis
    17897778
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17897778
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17897778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17897778
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     17897778
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class IV
   17897778
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 17897778
NCBI-ProteinID: XP_006303797
UniProt: R0IEL5
LinkDB
Position
Unknown
AA seq 356 aa
MAPASSPLPISSESDEKYANVKWEELGFALTPTDYMYVAKCKEGESFSQGKIVPYGDISI
SPCSPILNYGQGLFEGLKAYRTEDDRIRIFRPDQNALRMLTGAERLCMTPPSLDQFVEAV
KQTVLANKKWVPPPGKGTLYIRPLLIGSGASLGVAPAPETTFLVYASPVGGYHKVSSGLN
LKVDHKHHRAHSGGTGGVKSCTNYSPVVKLLLEAKSSGFSDILFLDAATGRNIEELSACN
IFIVKGNIVSTPPTSGTILPGVTRKSISELARDIGYQVQERDVSVDELLEAEEVFGTGTA
VVVTAVETVTFHDKKVKYRTGEAALSTKLRSMLTNIQMGIVEDKKGWMVEIDRCQG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctcctgcttcatcacctcttcctatttcaagtgaatcagatgagaaatatgccaat
gtgaaatgggaagagcttggattcgctctgactccaacagattacatgtatgtagccaaa
tgcaaagaaggcgagagcttttcacaaggaaagattgttccttatggggatatttctatt
agcccttgttctcctattctcaattatggccagggactctttgaaggcctcaaagcttac
aggacagaagacgaccggattaggattttcaggcctgaccaaaacgctcttcgtatgcta
actggtgccgagaggctttgtatgacacctccttctctggaccaattcgttgaagcagtt
aagcaaactgtgcttgccaacaagaaatgggttcctcctccgggtaaaggaactttgtat
ataaggcctctgctaatagggagcggtgcttcccttggagtagctccggcacctgaaacc
acatttctcgtatatgcatctccagtaggaggttaccataaggtgagctcaggcttgaac
ctcaaagttgatcataagcatcaccgagcccattcaggtggaacgggtggtgtcaagagt
tgcacaaactattctccagttgtgaaattgttgcttgaagcaaagtcatcgggtttctct
gatattctgttcctagatgcagcaactggtagaaacatcgaagagcttagtgcatgtaat
atcttcattgtcaagggaaacattgtgtccactccaccaacttcaggaaccattttacct
ggagtcacaaggaaaagcataagcgagctagctcgtgacattggctaccaggttcaagaa
cgcgatgtttctgtggatgagctactagaggcagaagaagttttcggcacagggactgca
gtggtcgttacagctgttgaaactgtgaccttccatgacaagaaggtaaaatacaggaca
ggagaagcagcgctgtctacgaagcttcggtcgatgttaaccaatattcagatgggcatt
gttgaagataagaaaggttggatggtggaaatcgatcgttgtcaaggctga

KEGG   Capsella rubella (pink shepherd's-purse): 17900156
Entry
17900156          CDS       T02984                                 
Name
(RefSeq) putative branched-chain-amino-acid aminotransferase 7
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00270  Cysteine and methionine metabolism
crb00280  Valine, leucine and isoleucine degradation
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
crb01240  Biosynthesis of cofactors
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17900156
   00280 Valine, leucine and isoleucine degradation
    17900156
   00290 Valine, leucine and isoleucine biosynthesis
    17900156
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17900156
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17900156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17900156
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     17900156
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class IV
   17900156
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 17900156
NCBI-ProteinID: XP_023632714
LinkDB
Position
Unknown
AA seq 357 aa
MAPSVQPSSSPLLASDADEKYADVKWDELGFSLVPTDYMYVAKYKQGESFAEGEIVPYGD
ISMSPCAGILNYGQGLFEGLKAYRTEDGRITLFRPDQNALRMQTGADRLCMTPPSPDQFV
EAVKQTVLANNKWVPPPGKGALYIRPLLIGTGAVLGVASAPEYTFLIYTSPVGNYHKGSS
GLNLKVDDKHRRAHSGGTGGVKSCTNYSPVVKPLLEAKSSGFSDVLFLDAATGKNIEEVS
TCNIFILKGNIVSTPPTSGTILPGITRKSISKLASDIGYQVQERDVSVEELLEAEEVFCT
GTAMVVKAVETVTFHEKKVKYKTGEEALSTKLHLMLTNIQMGVVEDNKGWMVDIISG
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggctccttcggtgcaaccttcctcatcacctcttcttgcaagtgacgcagatgaaaag
tatgcggatgtgaaatgggacgagctcggattcagtttggttccaacagattacatgtat
gtggcgaaatacaaacaaggagagagctttgccgaaggagaaattgttccttatggagat
atttcaatgagcccttgtgctgggattctcaattatggccagggactatttgaaggtctc
aaggcgtacaggacagaagatggacggatcacactcttccggcctgaccaaaacgctctt
cgtatgcaaacaggtgcggataggctttgtatgacacctccttctccggaccaatttgta
gaagctgttaagcaaactgtgcttgccaacaacaaatgggtacctcctcctggtaaagga
gctttgtatattaggcctctactcataggtactggtgctgtcttaggagtagcttcagca
cctgaatatacgttcctcatttacacatctcccgttggaaattatcataagggaagctca
ggcttaaaccttaaagttgatgataagcatcgccgagcccactctggtggaacagggggt
gtgaagagttgtaccaactattctccagttgtaaaaccgttgctggaagcaaagtcatcg
ggtttctctgatgtcttgttcctggacgcggcaactggtaaaaacatcgaagaggtttct
acttgtaacatctttattctcaagggaaacatagtgtcaactccaccaacttcaggaacc
attttaccaggaattacaaggaaaagcataagcaagctagctagtgatattggctaccag
gttcaagaacgggatgtttcagtggaggagctcttagaggcagaagaagtattctgcaca
gggactgcaatggtcgtcaaagctgttgagactgtgaccttccatgaaaaaaaggtgaaa
tacaagacaggagaagaggcattgtcaacgaagcttcacttgatgttaaccaatattcaa
atgggagttgttgaagataacaagggttggatggtggatatcatcagtggctga

KEGG   Capsella rubella (pink shepherd's-purse): 17900879
Entry
17900879          CDS       T02984                                 
Name
(RefSeq) branched-chain-amino-acid aminotransferase 2, chloroplastic
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00270  Cysteine and methionine metabolism
crb00280  Valine, leucine and isoleucine degradation
crb00290  Valine, leucine and isoleucine biosynthesis
crb00770  Pantothenate and CoA biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
crb01240  Biosynthesis of cofactors
Module
crb_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
crb_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17900879
   00280 Valine, leucine and isoleucine degradation
    17900879
   00290 Valine, leucine and isoleucine biosynthesis
    17900879
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    17900879
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17900879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:crb01007]
    17900879
Enzymes [BR:crb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     17900879
Amino acid related enzymes [BR:crb01007]
 Aminotransferase (transaminase)
  Class IV
   17900879
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 17900879
NCBI-ProteinID: XP_006305039
UniProt: R0GPU4
LinkDB
Position
Unknown
AA seq 388 aa
MIKAFSSLRKNLALPLHLHIRTLQTFAKYNAQAATALREERKKPIYQNGDDEYADLDWDN
LGFGLTPADYMYVMKCSKDGAFTEGEVSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKEDG
KLLLFRPDQNAIRMKLGAERMLMPSPSVDQFVNAVKQIALANKRWVPPTGKGTLYIRPLL
MGSGPILGLGPAPEYTFIVYASPVGNYFKEGVAALNLYVEEEYVRAAPGGAGGVKSITNY
APVLKALSRAKSLGFSDVLYLDSVKKQYLEEASSCNVFVVKGRTISTPETNGTILEGITR
KSIMEIASDQGYKVVERAVHVDEVMDADEVFCTGTAVVVAPVGTITYQNKRVEYKTGDES
VCLKLRSILVSIQTGLIEDNKGWVMNIN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgatcaaagcattctcatctctacgcaaaaatttggctctacctcttcatttacatatt
cgtacgctacagactttcgccaagtacaacgcacaagctgccacggccttgagagaagag
cgtaagaaacctatttatcaaaatggggatgatgagtatgcggatttggattgggataat
ctggggtttggtctaactccagctgattacatgtatgtcatgaaatgctcaaaagacggt
gcatttactgaaggagaagttagtccctatggaaatattcagctaagtccttctgctgga
gtcttaaactatggacaggcgatatatgaaggtacaaaagcatacaggaaagaagatggg
aagcttcttctttttcgcccggatcaaaacgctatccgaatgaagcttggtgctgaacga
atgctcatgccttctccttcagttgatcagtttgttaatgcggttaaacaaatcgctctc
gccaataaacgttgggttcctcctacagggaaagggactttgtacattaggcctctgttg
atgggaagtggtcctattcttggtttaggccctgcacctgaatatacattcattgtctat
gcatctccagttggtaactacttcaaggaaggggtggctgctcttaacctctatgttgag
gaagagtatgtccgtgcagctcctggtggagctggaggggtcaagagcatcacaaattat
gccccagttttgaaagcactgagcagagccaagagcctcgggttttcagacgttctttat
cttgattctgtcaagaagcagtatctagaggaggcttcttcttgcaatgtctttgttgtg
aagggtcgaacaatctcaactcctgaaactaatggaacaattcttgagggtattacgcgg
aaaagtataatggagatcgcaagtgatcaaggttataaggtagtagagagggcagttcat
gtggatgaagtaatggatgcagatgaagtcttttgcaccggaactgcagtagtagttgct
cctgtaggcactataacatatcagaacaaaagggtagaatataaaaccggggatgaatct
gtctgcctgaaactgcgttccatccttgtctctatccaaacaggattgatagaagacaac
aagggatgggtcatgaatatcaactga

DBGET integrated database retrieval system