KEGG   Capsella rubella (pink shepherd's-purse): 17891676
Entry
17891676          CDS       T02984                                 
Name
(RefSeq) threonine dehydratase biosynthetic, chloroplastic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00260  Glycine, serine and threonine metabolism
crb00290  Valine, leucine and isoleucine biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    17891676
   00290 Valine, leucine and isoleucine biosynthesis
    17891676
Enzymes [BR:crb01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     17891676
SSDB
Motif
Pfam: PALP Thr_dehydrat_C PAC4
Other DBs
NCBI-GeneID: 17891676
NCBI-ProteinID: XP_006297203
UniProt: R0G418
LinkDB
Position
Unknown
AA seq 591 aa
MDSVRLPTAPSSLRSHIPLPSKPVIGVTHFSRSRIPVAVMSRDETSMAPPPPVPPLPRLK
VSPSSLQYPAGYLGAVPERTNDPENGSIAEAMEYLTNILSTKVYDIAIESPLQLAKKLSK
RLGVRMLLKREDLQPVFSFKLRGAYNMMVKLSADQLAKGVICSSAGNHAQGVALAASKLG
CNALIFMPVTTPEIKWQSVETLGATVILKGDTYDEAQEHAKKRAEEEGLTFIPPFDHPDV
IAGQGTIGMEITRQAKGPLHAIFVPVGGGGLIAGIAAYVKRVAPEVKIIGVEPADANAMA
LSLHHGERVILDQVGRFADGVAVKEVGEETFRISRNLMDGVVLVTRDAICASIKDMFEEK
RNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGANMNFDKLRIVTELANVGRQQEAVL
ATLMPEKPGSFKKFCELVGPMNITEFKYRCSSEKEAVVLYSVGVHTADELKELQKRMESS
QLKTVNLTTSDLVKDHLRYLMGGRSSVEDEVLCRFTFPERPGALMNFLDSLSPRWNISLF
HYRGQGETGANVLVGIQVPEQEMEEFKDRAKALGYEYFLVSDDENFQLLMH
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggattccgtccggcttccaacggctccatcctctctccgtagccacattcccctgcca
tccaaaccagtgatcggagtcactcacttctcccgatctcggatcccagtggcagttatg
tcccgagacgaaacatctatggctccaccgcctccggtgcctcctctgccacgtctcaag
gtctctccgagctcgttgcaataccctgccggttatctcggtgctgtaccggagcgtacg
aacgatccggagaacggaagcatcgcagaggctatggagtatttgacgaatatactgtcc
actaaggtttacgacatcgccattgagtcaccactccagttggcaaagaagctgtctaag
aggttaggtgttcggatgcttctcaaaagagaagacttgcaacctgttttctcgtttaag
cttcgtggagcttacaatatgatggtgaaactttcagcggatcagttggcaaaaggagtt
atctgctcctcagctggaaaccatgctcaaggagttgctttagctgctagtaaacttggc
tgcaatgctctgatttttatgcctgttacaaccccagagatcaagtggcaatctgtcgag
actttgggtgcaacggttattctgaagggtgatacgtatgatgaagcacaagaacatgct
aagaaacgagctgaagaagagggtctgacgtttatacctccttttgatcacccggatgtt
attgctggacaagggactattgggatggagatcactcgtcaggctaagggtccattgcat
gctatatttgtgccagttggtggtggtggtttaatagctggcattgctgcttatgtgaag
agggttgctcccgaggtgaagatcattggtgtagaaccagctgatgcaaatgcaatggca
ttgtcgctgcatcacggtgagagggtcatattggaccaggttggtcgatttgcagacggg
gttgcagttaaagaggttggtgaagagacttttcgtataagcagaaacctaatggatggt
gttgttcttgtcacacgtgatgctatttgtgcatcaataaaggatatgtttgaggagaaa
cggaacatattggaaccagcaggagctctcgctctcgctggagctgaggcatactgcaaa
tattatggcctaaaagacgtgaatgtcgtagccataaccagtggtgcaaacatgaacttc
gacaagctaaggattgtgacagaactcgccaatgtcggtaggcaacaggaggctgttctt
gctactctcatgccggaaaaacctggaagctttaagaaattctgtgaactggttggaccg
atgaacataacagagttcaaatacagatgtagctcagaaaaggaggctgttgtcctatac
agtgttggagttcacacagccgatgagctcaaagaactacagaagagaatggaatcctct
caacttaaaactgtcaatctcacaaccagtgacttagtgaaagatcacctgcgttacttg
atgggtggaagatcaagtgttgaagacgaggttctatgccgattcacctttcccgagaga
cctggtgctctaatgaacttcttggactctttgagtccacgttggaacataagccttttc
cattaccgtggacagggtgagacgggcgcaaatgtgctggtggggatccaagtaccagag
caagaaatggaggaatttaaagaccgagcaaaagctcttggatacgaatacttcttggta
agtgatgacgagaattttcagcttctgatgcactga

DBGET integrated database retrieval system