KEGG   Capsella rubella (pink shepherd's-purse): 17894344
Entry
17894344          CDS       T02984                                 
Name
(RefSeq) 2-isopropylmalate synthase 2, chloroplastic isoform X1
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00620  Pyruvate metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    17894344
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17894344
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     17894344
SSDB
Motif
Pfam: HMGL-like LeuA_dimer
Other DBs
NCBI-GeneID: 17894344
NCBI-ProteinID: XP_023643860
LinkDB
Position
Unknown
AA seq 629 aa
MASSILRTTNSPYISVPSIPALSSSSSSPISSIHLRSDNHHAVSLCTAAKFRVSCSISGS
YPLPPHTPRLRPDYIPNRISDPNYVRIFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGV
DIIEAGFPAASKDDFEAVKTIAETVGNTMDENGYVPVICGLSRCNKKDIETAWEAVKYAK
RPRIHTFIATSDIHLKYKLKKSKEEVIEIARNMVGFARSLGCQDVEFSPEDAGRSEREYL
YEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIQNVIISTHCQNDLGLST
ANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMT
SKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIMSPEEIGLERSNEAGI
VLGKLSGRHALKDRLNELGYVLDDGQLSNLFWRFKAVAEQKKRVTDADLIALVSDEVFQP
EAVWKLLDIQITCGTLGLSTSTVKLSDSDGKEHVACSIGTGPVDAAYKAVDLIVKEPATL
LEYSMNAVTEGIDAIASTRVLIRGGNYYSSTNAITGESVERTFSGTGAGMDIVVSSVKAY
VGALNKMLGFKEHSSTLRKISSEASDVPV
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggcgtcttcgatcctcagaaccactaattcaccatatatctctgtaccttcaattccc
gccttatcatcctcctcttcctcaccaatttcatctattcatctccgatcagacaaccac
catgctgtctccctttgcaccgccgcgaagttccgtgtctcgtgctcaatctccggttct
tatcctctaccacctcatactcctcggcttcgtcctgattacatccctaatcgcatttca
gaccctaattacgtcagaatcttcgacacgactctcagagacggcgaacagtctcccgga
gctacgctaacgtccaaggaaaagctcgatatcgctcgtcagttagccaagctcggagtc
gacatcattgaagctgggttccccgctgcttcgaaagacgatttcgaggctgtgaagacc
atagcggagactgttggcaataccatggacgaaaatggctatgtccctgttatctgtggg
ctctcgagatgtaacaagaaggatatagagacggcttgggaggctgtgaagtatgctaaa
cggcccaggattcatacgtttattgcaactagtgatattcatttgaagtataagttgaag
aagagcaaagaagaggttattgagatagctcggaatatggttggatttgccaggagcttg
ggttgtcaagatgttgaatttagtcctgaagatgctggaagatcggagagagagtatttg
tacgagattcttggtgaagtgataaaagctggagctacaactctcaacatacctgacact
gttggtataaccttgcctagtgagtttggtcagttgattgctgatattaaagctaatact
cctgggatccagaatgttataatctctacacattgtcaaaatgatcttggactctccact
gccaacactctatctggtgcacattccggtgcaagacaagtggaagtgacgatcaatgga
attggcgaaagagctggaaacgcttcattagaagaggttgtcatggccataaaatgccga
ggagatcatgtattaggaggcctgtttactggaatcgatacccggcacattgtaatgaca
agcaagatggttgaagagtacactggtatgcaaacgcagccccataaggctattgtagga
gcaaacgcctttgcacacgaaagtggtattcatcaggatggaatgctgaagcacaagggt
acatatgaaattatgagccccgaagagattggactcgagcgatcaaatgaagctggtatt
gtattaggaaagctcagtgggcgtcacgcactgaaagaccgtttgaatgagctcggttat
gtcctggatgatggtcagctcagcaaccttttttggcgtttcaaagctgtcgcagagcaa
aaaaagagagttaccgatgcagacttaatagctttagtatctgatgaagtgtttcagcca
gaggcagtatggaaacttttggacatacagataacttgtggaactctcggtctctcaaca
tcaacggtaaaactttcggattccgatggcaaagagcatgtagcttgttctattggaact
ggacctgtagatgcagcttataaggcagttgatcttatcgttaaggaacccgcgactcta
cttgagtactcgatgaatgcagtaacagaaggtattgatgctattgcgagcacacgggtt
ctaatccgcggaggcaactactactcatcaacaaacgccataactggtgaatctgttgaa
agaacttttagtggaaccggagcagggatggacattgtagtatcaagcgttaaagcttat
gttggagctttgaacaaaatgttgggtttcaaagaacactcctctactttgagaaaaata
tcttcggaggcaagtgacgtccctgtctga

KEGG   Capsella rubella (pink shepherd's-purse): 17899709
Entry
17899709          CDS       T02984                                 
Name
(RefSeq) 2-isopropylmalate synthase 1, chloroplastic
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00620  Pyruvate metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    17899709
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17899709
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     17899709
SSDB
Motif
Pfam: HMGL-like LeuA_dimer AP_endonuc_2
Other DBs
NCBI-GeneID: 17899709
NCBI-ProteinID: XP_023645693
LinkDB
Position
Unknown
AA seq 628 aa
MASSLLRNPNLLSTTITTTPSLPTFSSKPTPSSFRFQPSRHCSISLRSRTLRLSCSISDP
APLPPHIPRRPRPEYIPNRISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLG
VDIIEAGFPAASKDDFEAVKTIAETIGNTVDENGYVPVICGLSRCNKKDIERAWDAVKYA
KRPRIHTFIATSNIHLEHKLKKTKAQVIEIARSMVRFARSLGCEDVEFSPEDAGRSEREY
LYEILGEVIKAGATTLNIPDTVGITLPSEFGQLIADIKANTPGIKNVIISTHCQNDLGLS
TANTLSGAHSGARQVEVTINGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVM
TSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIICPEEIGLERSNDAG
IVLGKLSGRHALKDRLTELGYDLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEVFQ
PEAVWKLLDIQVTCGTLGLSTATVKLADADGKEHVACSMGTGPVDSAYKAVNLIVKEPAT
LLEYSMNAVTQGIDAIATTRVLIRGSNKYSSTNAITGEEVLRTFSGTGSEIDIVVSSVKA
YVGALNKMLDFKENAPTKVPSQKSRVPA
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcgtcttcgcttctgagaaaccctaatctcttatcaacaacaatcaccaccactcct
tctcttcccaccttctcctcgaaaccaacaccttcctcattccgattccaaccgtcccgt
cactgttccatctctctccgaagccgaacacttcgtctctcatgttcaatctcagatcct
gctcctctaccacctcacatccctcgccgtccccgtcccgaatacatccccaaccgcatt
tccgatcccaactacgtccgtgtcttcgatacgactctccgggacggtgagcagtctcca
ggcgctacactcacttctaaggaaaagctagacatcgctcgtcagctagccaagctcggc
gtggacattatcgaggctggtttccccgccgcctcaaaagatgattttgaagcggtaaag
actatagctgaaacaattggtaacactgttgatgagaatggctatgttcctgttatctgt
ggcctttctagatgcaataagaaggacattgagagggcttgggatgctgtcaagtatgct
aaacgtcctaggatccatactttcattgctaccagtaatattcatttggagcataaactg
aagaaaaccaaagcacaagtcatcgaaattgctaggagtatggttagatttgccaggagc
ttgggttgtgaagacgtcgagttcagtccagaagatgcaggaagatccgagagagagtac
ttgtacgagattcttggtgaagtgattaaagctggagcaacaacactcaacatacctgat
accgttggtataactttgcctagtgagtttggtcaattaatcgctgatataaaagccaat
actccagggattaaaaatgttatcatctcaacgcattgtcagaatgatcttggactctct
acggccaacactttatctggagcacattcaggtgcgagacaggtcgaagtgacgatcaat
gggatcggtgaaagagctggaaacgcttcactggaagaggttgtgatggccataaaatgt
cgtggagatcatgtattaggaggtctattcactggaatcgatactaggcacattgttatg
acaagcaagatggttgaagagtacactggaatgcagacacagcctcataaggctattgta
ggagcgaatgcctttgcgcatgaaagtggtattcaccaggatggaatgctgaaacacaag
ggtacgtatgaaattatatgtcctgaagaaattggacttgaacgatcaaatgatgctggc
attgtcttggggaagctcagtgggcgtcatgccctgaaagaccgtttgactgagcttggt
tatgatttagatgatgaacagctaagtacaattttctggcgcttcaaaacggtggctgag
cagaaaaagagagttactgatgcggacataatagctttagtatctgatgaagttttccag
ccagaagccgtgtggaaactcttggacattcaggtaacgtgtggaaccctcgggctttca
acagcaactgtaaaacttgctgacgctgatggcaaagagcatgtcgcttgttctatggga
actgggcctgtcgattcagcatacaaggcagtcaatcttattgtaaaggaaccagcgacg
ctgcttgagtactcgatgaatgcagtaacacaaggcatcgatgctatcgcaaccacacga
gtcctcatccgcggaagcaacaaatactcatctacaaacgcaataaccggtgaggaagtt
ctaaggacctttagtggaacgggatcagaaatagatattgtggtgtcaagcgtcaaagct
tatgtcggagctttgaacaaaatgctggactttaaagaaaacgcccccacaaaagttcct
tctcaaaaaagcagagtccctgcctga

DBGET integrated database retrieval system