KEGG   Capsella rubella (pink shepherd's-purse): 17894397
Entry
17894397          CDS       T02984                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00660  C5-Branched dibasic acid metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    17894397
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17894397
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     17894397
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 17894397
NCBI-ProteinID: XP_006301096
UniProt: R0HW14
LinkDB
Position
Unknown
AA seq 405 aa
MAAALQTNIRPVKVPATFRALSEQSSAPFRVRCAVASPGNKRYNITLLPGDGIGPEVVSI
AKNVLQQAGSLEGVEFSFREMPIGGAALDLVGVPLPEETISAAKESDAVLLGAIGGYKWD
NNEKHLRPEKGLLQLRACLKVFANLRPATVLPQLVDASTLKREVAEGVDLMVVRELTGGI
YFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKRRGKLCSVDKANVLEASI
LWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTMVTNNIFGDILSDEASMITGS
IGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAKRIE
DAVLVALNNGFRTGDIYSAGTKLVGCKEMGEEVLKSVDSQVPASV
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcggcggcgctgcagacgaatatccggccggtcaaggtgccggctacgttcagagct
ctctccgaacaatcttccgcaccctttagagtaagatgcgccgttgcttcccctgggaat
aaacgttacaacatcactctccttcccggtgacggcatcggtccggaggttgtctctatt
gccaagaatgtgcttcaacaagctggatctttggaaggagtggaatttagcttccgggag
atgcccattggaggagctgctttggatttggtcggagtgcccttgccagaggagaccatc
tcagctgcaaaagaatcagatgcagtgcttcttggagccattggagggtacaaatgggat
aacaatgaaaaacatctgaggcctgagaaggggttacttcagcttcgtgcatgtctcaaa
gtctttgcaaatcttagacctgctacagttctgccgcagttagtggatgcttccacctta
aagagagaggtagcagaaggtgttgatctaatggttgtgagggagcttacaggaggtatt
tactttggagagccaaggggcataaagaccaatgaaaatggcgaggaagttgggtttaat
actgaggtttatgctgctcacgagattgatagaattgctcgtgttgccttcgagaccgct
cggaaacggcgtggcaagctgtgctcagtcgacaaagctaatgtcttggaagcctcaatt
ttatggaggaaacgagtgacagcattagcctctgaatatcctgatgttgagctttcacat
atgtatgttgacaatgccgcgatgcagcttgttcgtgacccaaaacagtttgacactatg
gtgacaaacaacatttttggtgatatattatccgatgaagcttcaatgatcacaggaagc
attggaatgctgccatctgctagtcttagtgattcgggacctggactctttgaacctata
catggttctgcacctgatattgcgggacaggataaggcaaacccattggcaaccattctc
agtgctgcaatgcttctgaaatacggacttggagaagaaaaggcagccaagagaattgaa
gacgcagtgttggttgctctgaacaatgggttcagaactggtgacatttactctgcagga
actaaactggtgggctgcaaggagatgggagaggaggttctgaagtcggtagactcccaa
gtgccagcttctgtttaa

KEGG   Capsella rubella (pink shepherd's-purse): 17895032
Entry
17895032          CDS       T02984                                 
Name
(RefSeq) 3-isopropylmalate dehydrogenase 2, chloroplastic
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
crb  Capsella rubella (pink shepherd's-purse)
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00660  C5-Branched dibasic acid metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
crb01230  Biosynthesis of amino acids
Module
crb_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    17895032
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17895032
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     17895032
SSDB
Motif
Pfam: Iso_dh DUF1979
Other DBs
NCBI-GeneID: 17895032
NCBI-ProteinID: XP_006301906
UniProt: R0HY45
LinkDB
Position
Unknown
AA seq 409 aa
MTGVRGFHVGSTQNPFAFASATKHNFRGVCLIRCAANTPKKRYTIAVLPGDGIGNEVIPV
AVEVLRLAGSLEGIYFSFEELPIGGVALDLVGVPLPGETLTRAKQSDAVLLGAVGWPKWD
NNPKHLKPITALLQLRAALEVFANLRPITVLPQLVNSTYLRKETAEGVDLLIIRELTGGI
YNAHPRGFTTNEQGEEIGFCTESYSASEVDHIARVAFNIAKQRRGKLCSVDKATILEGSM
LWRKRVTSMASEYPEVEVSHLLIDTAAMDLVRHPRQFDTILTGVMFGDILSDLAAMIPGS
VGLLPSAALGDSGPGIFEPVHGSAPKHYGKDTVNPMAAVLSAAMLLRYGLKEENAAKRIE
EAVCDVLDRGFRTRDIHTPGTTCVGCRRMGEEILRSLDAKVSASTKSLV
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgacgggagttcgaggattccacgtcggcagtacccagaatccgtttgcgtttgcatcc
gccaccaaacataactttaggggggtgtgtctgatcagatgtgccgccaacactccgaag
aaacggtacactatcgcggtgcttcccggcgatggtatcggcaacgaagtcatcccagtc
gctgtggaagttcttcgtttagctgggtctcttgaagggatatattttagcttcgaggag
ttgcctataggaggcgttgctttagatctcgtcggagtcccattacctggggaaacattg
acaagggcaaagcaatcagacgctgttcttctcggagctgttggatggccgaaatgggat
aacaatccgaagcatttgaagccaataacggctttgttgcagctccgtgcggctcttgaa
gtatttgccaatttaagacccatcacagtgttaccacagttggttaattcgacatatcta
agaaaagaaacagctgaaggggttgaccttttgatcatccgcgagcttactgggggtatt
tacaatgcgcatcctcggggttttaccacaaatgaacaaggtgaagaaattggattttgt
actgagtcctactctgcaagtgaggttgatcacattgctcgcgttgcatttaatattgct
aagcaaagacgtggcaaactttgttctgttgacaaggctactatcttggagggatcaatg
ttgtggaggaaaagagtaacatcaatggcttcagagtatcctgaggttgaagtgagtcat
ctgctgattgacactgctgcgatggatcttgttcggcacccaagacagttcgataccatt
ctgactggggtcatgtttggtgatattctttctgatctcgcggctatgatcccgggaagt
gtaggattgcttccatccgctgcccttggtgattcagggcctggaatcttcgaacctgtg
catggatctgcacctaaacactacggaaaggacacagtgaaccccatggcagctgtacta
tcagctgccatgcttttgagatatgggttgaaagaagaaaatgcagcaaagcgaatagaa
gaagcagtttgtgatgtcttggaccgtggattcagaactcgtgacattcacacacctgga
actacgtgcgtaggttgcaggagaatgggagaggagatattgagatcccttgatgctaaa
gtctctgcttcgactaaaagcttggtttag

DBGET integrated database retrieval system