Magallana gigas (Pacific oyster): 105320682 Help Entry 105320682         CDS       T03920                                  Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism crg  Magallana gigas (Pacific oyster) Pathway crg03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:crg00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     105320682  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:crg03400]     105320682 DNA repair and recombination proteins [BR:crg03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      105320682 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X RTTN_N DUF4042 Motif Other DBs NCBI-GeneID:  105320682 NCBI-ProteinID:  XP_011417021 UniProt:  A0A8W8JDK9 LinkDB All DBs Position 7:28248638..28250866 Genome browser AA seq 78 aa AA seqDB search MSGGTNFKEKTVQNILLQFFKDEKIKINAEALSLMTELLNIFVSEAVLRTIKEAKKDHQD QIPIDYFEKILPQLLLDF NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctggcggtacaaattttaaagagaaaacagttcagaatattttacttcagtttttc aaagatgaaaaaataaaaataaatgcagaggccttgagtcttatgacagaactcctaaac atttttgtttcagaagcagtattgagaacaatcaaggaagcaaagaaagatcaccaagac cagataccaattgattattttgaaaagattttgccacagttgttactggatttttga

DBGET integrated database retrieval system