KEGG   Citrobacter rodentium: ROD_00901
Entry
ROD_00901         CDS       T01145                                 
Symbol
ftsI
Name
(GenBank) peptidoglycan synthetase (penicillin-binding protein 3)
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
cro01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_00901 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_00901 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_00901 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cro03036]
    ROD_00901 (ftsI)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ROD_00901 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ROD_00901 (ftsI)
Chromosome and associated proteins [BR:cro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ROD_00901 (ftsI)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: CBG86870
UniProt: D2TGE1
LinkDB
Position
107179..108936
AA seq 585 aa
MKAAAKPKRQEEQANFISWRFALLCGCILLALVFLLGRVAWLQIIAPDMLVRQGDMRSLR
VQEVATSRGMITDRSGRPLAVSVPVKAIWADPKEVHEAGGVRVGDRWKALSTALNIPLDQ
LAARINANPKGRFIYLARQLNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTN
VDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQAL
VYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKDAMRNRTITDVF
EPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSSNVG
VSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMV
TPLQLARVYATIGSYGVYRPLSITKVDPPVPGERIFPESIVRTVVHMMESVALPGGGGVK
AAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGG
AVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVINQGEGTGGRS
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgaaagcagcggcaaaaccaaaacgtcaggaagaacaggccaactttatcagttggcgt
tttgcgttgctctgcggctgcattttactggcgctggtttttctgcttgggcgcgtggcc
tggctgcagattatcgccccggatatgctggtgcgccagggcgacatgcgttcgctgcgc
gtgcaggaagtggcgacttcacgcggtatgattaccgaccgctccgggcgtccgctggcg
gtcagcgtgccggttaaagccatctgggccgacccgaaagaggtgcacgaagcgggcggc
gtgcgcgtgggcgatcgctggaaagcgctctctaccgcgctgaatatcccgctcgaccag
ctggccgcgcgcatcaacgccaacccgaaagggcgttttatctacctggcgcgtcagctt
aacccggatatggccgactacattaaaaagctgaagctgccgggcattcatctgcgtgaa
gaatcacgtcgttactatccttccggcgaagtgaccgctcacctcattggtttcaccaac
gtcgacagccagggtattgagggcgtcgagaaaagctttgataaatggcttaccggtcaa
ccaggcgagcgtattgtgcgtaaagaccgctatggccgcgtgattgaggatatctcctcc
accgacagccaggcggcgcacaatctggcgttaagcattgatgagcgcctgcaggcgctg
gtttaccgtgaactgaacaacgccgtggcgtttaacaaagcggagtccggcagcgcggtg
ctggtggatgtgaataccggtgaagtgctggcgatggccaacagcccatcctacaacccc
aacaacctgagcggcacgccgaaagatgcgatgcgtaaccgcaccatcaccgacgttttc
gaaccgggatctaccgtcaaaccgatggtggtaatgaccgcgctgcagcgcggcatcgtc
aatgaaaatacggtgctcaacaccgttccttatcgaattaacggtcacgaaatcaaagac
gtggcgcgctatagcgaattaaccctgaccggggttttacagaagtcgagtaacgtcggt
gtttctaagctggcgttagcgatgccgtcctcagcgttagttgatacttactcacgtttt
gggctgggaaaagcgaccaatttggggttggtcggagaacgcagtggcttatatcctcaa
aaacaacggtggtctgacatagagagggccaccttctctttcggctacgggctaatggta
accccgttacagttagcgcgagtctacgcaaccatcggcagctatggcgtttatcgcccg
ctgtcgattaccaaagttgatccgccggtgcctggggagcgtatcttcccggaatccatc
gtgcgcaccgtcgtgcatatgatggaaagcgtggcgctgccgggcggcggcggcgtgaaa
gcggcaatcaaaggctaccgtatcgcaatcaaaaccggtacggcgaaaaaagtggggccg
gatggccgctacatcaacaaatatattgcttataccgcaggcgttgcgcctgcgagtcag
ccgcgcttcgcgctggttgttgttatcaacgatccgcaggcgggtaaatactacggcggc
gccgtttccgcgccggtatttggtgccatcatgggcggcgtactgcgcaccatgaacatc
gaaccggatgcgctggcaacgggcgaaaaaagtgaattcgtaattaatcaaggcgaggga
acaggtggcagatcgtaa

KEGG   Citrobacter rodentium: ROD_18611
Entry
ROD_18611         CDS       T01145                                 
Name
(GenBank) penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
cro01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_18611
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_18611
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_18611
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cro03036]
    ROD_18611
Enzymes [BR:cro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ROD_18611
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ROD_18611
Chromosome and associated proteins [BR:cro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ROD_18611
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: CBG88616
UniProt: D2TM39
LinkDB
Position
complement(1981666..1983411)
AA seq 581 aa
MKKKSDGAARSFTPVRFALLCVAILLSLGLLLGRVAWLQLISPDKLVRQQDMRSLREVTT
ASPRGMIVDREGHPLAVSVPVDAVWADPKTLLSKGGVGYDARWQALADTLHLSLSTLAER
VNHAPTGRFLYLARQVSPQQAQWIDQLNLPGINLREESRRFYPAGHVAANLIGFTNIDGQ
GIEGIEKSFNAQLMGKPGSRLVRKDKFGHVIENITEVSPVPAHNLQLSIDERLQTVTEDA
LDNAVTWNKAESGAAILVSIATGEVLAMANYPDFNPNNRDGAVLDDFRNRAISDTFEPGS
TVKPLVIMTALQQGIVQPDSVIDTHPFILDGHRIRDVGFYPELTLTGILQKSSDTGVSHL
SLAMPVQRLIDTYKNFGFGQPTGLGLTGESRGLMPQRRYWSDLDRATFAFGYGLMVTPLQ
LAHVYATIGSFGIYRPLSITRIDPPVIGKRVMPEALVRQVEHMMESVALPGGGGTKAAVR
GYRVAVKTGTAKKIGDDGKYVDKYVAYTAGVAPASNPQFALVVVINNPQNGSYYGGAVSA
PVFSQIMGDVLRLENVKPDGMPPDSSHLLVMDSHKAFAHTL
NT seq 1746 nt   +upstreamnt  +downstreamnt
gtgaaaaagaaaagtgacggcgcggccaggagttttacccctgtgcgttttgcgctgctt
tgtgtggcgatattgctgagtcttggattattgctgggccgggtggcgtggctgcagctg
atttcccccgataagctggtcaggcagcaggacatgcgctcactgcgtgaggtgaccacc
gcgtcgccacgcgggatgatcgtcgacagggaagggcatccgctggccgtcagcgtgccg
gtggatgccgtctgggccgatccgaaaaccttgctgagtaaaggcggcgtcggctatgac
gcacgctggcaggcgctggctgatacgctgcatttatcgctcagtacgctggcggaacgc
gttaaccatgcgccaacgggtcgctttctttatctggcgcggcaggtttcaccgcagcag
gcgcagtggatcgaccaactcaatcttcccggtattaacctgcgcgaagagtcgcgtcgc
ttttatccggcaggccatgtcgccgccaatctgatcggcttcaccaatattgacgggcag
ggcatcgaaggcatcgagaaaagctttaatgcgcagctgatgggcaagccggggtcgcgt
ctggtacggaaagataaatttggtcacgttattgaaaacattaccgaagtcagtccggtg
ccggcgcacaatttacagctcagcattgacgagcggctgcaaaccgtcacggaagatgcg
ctggataatgccgtcacctggaataaggcagaatcgggagccgcaatactggtgagtatt
gccacgggggaggtgctggcgatggcgaactatcctgactttaatcccaacaaccgtgac
ggcgcggtgctggatgattttcgcaatcgcgctatcagcgatacttttgagcctggttcc
acggtgaagccgctggtgattatgactgcgctgcagcaaggcattgtgcagccggacagc
gtcattgacacccatccctttatccttgacggacaccgtattcgcgacgtcggtttttac
cccgagctgaccctgaccggcatattacaaaaatcgagcgacaccggcgtctcgcatctg
tcgctggcaatgcccgtccagcggcttattgacacttataagaactttggcttcggccag
ccgaccgggctggggctcaccggtgaaagccggggactgatgccgcagcgccgctactgg
agcgatctggatcgcgccacgtttgcttttggctacggtctgatggtcacgccgctgcag
ctggcgcacgtgtacgccaccattggcagctttggtatctatcgccccctctctattacc
cgcatcgatccgccggtgatcgggaaacgggtgatgccggaagcgctagtccgccaggtg
gaacatatgatggaaagcgtggcgctgccgggcggcggcgggacgaaagcggcggtgcgg
ggctatcgcgtggcggtgaaaaccggcactgccaagaagattggcgacgacggaaaatac
gtggataaatatgtggcttataccgcaggcgtcgcgccggccagcaatccgcagtttgcg
ctggtggtggtgattaacaatccgcaaaacggttcatactacggcggcgcagtatcagct
ccggtgttcagtcagattatgggggatgtgctgcggctggaaaatgtcaaacccgatgga
atgccccctgactccagccatctgctggtcatggacagccataaagcgtttgcgcacacg
ctgtga

DBGET integrated database retrieval system