KEGG   Citrobacter rodentium: ROD_00961
Entry
ROD_00961         CDS       T01145                                 
Symbol
murG
Name
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(penta peptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
cro  Citrobacter rodentium
Pathway
cro00550  Peptidoglycan biosynthesis
cro01100  Metabolic pathways
cro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ROD_00961 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ROD_00961 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
    ROD_00961 (murG)
Enzymes [BR:cro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     ROD_00961 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:cro01011]
 Precursor biosynthesis
  Glycosyltransferase
   ROD_00961 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_trans_4_2 OTCace
Other DBs
NCBI-ProteinID: CBG86876
UniProt: D2TGM7
LinkDB
Position
115401..116468
AA seq 355 aa
MSGQAKRLMVMAGGTGGHVFPGLAVAHHLMAQGWEVRWLGTADRMEADLVPKHGIEIDFI
RISGLRGKGVKALLAAPLRIFNAWRQARAIMKAFKPDVVLGMGGYVSGPGGLAAWSLGIP
VVLHEQNGIAGLTNKWLAKIATRVMQAFPGAFPKAEVVGNPVRTDVLALPLPQARLSGRE
GPIRVLVVGGSQGARVLNQTLPQAAAKLGSAVTIWHQSGKGAQQAVEQAYADAGQPQHKV
TEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQHKDRQQYWNALPLEQAGA
ARILEQPQFTVDAVVSTLSGWNREVLLEMAQRARAAAIPDATERVANEVSLVARA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgagtggtcaggcgaagcggttaatggtgatggcgggcggtaccggcggacacgtgttc
ccggggctggcggtcgcgcaccatttaatggctcagggctgggaagttcgctggctgggc
accgcagaccgtatggaagccgatttagtgccgaagcacggtattgaaatcgacttcatc
cgtatttccggcctgcgcggaaaaggcgtgaaggcgctgcttgccgcgccgctgcgtata
ttcaacgcctggcgccaggcgcgggcgatcatgaaggcgtttaaaccggatgtggtgctc
ggtatgggcggttacgtctccggtcccggcggtcttgccgcctggtcgctgggcattcct
gtggtgctgcacgaacaaaacggcattgccggattaaccaataaatggctggcgaagatc
gctaccagagtaatgcaggcgtttcccggcgcgtttccgaaagcggaagtggtcggcaat
ccggtacgtaccgacgtgctggcgctgccgctgccgcaggcgcgcctgagcgggcgtgaa
ggtccgattcgcgtgctggtggtcggcggttcgcagggcgctcgcgtactgaatcagacg
ctgccgcaggcggccgcaaagctgggcagcgcagtcaccatctggcatcagagcggcaaa
ggcgcgcagcaggcggtagaacaggcctatgctgacgcgggccagccgcagcataaggtg
actgaatttattgatgatatggctgccgcttacgcatgggcggatgtggtggtctgtcgt
tcaggcgcgttaacggtcagtgaaatcgccgcagccggtttacccgcgctgtttgtgccg
tttcagcataaagaccggcagcagtactggaatgcgctaccgctggagcaggcgggcgcg
gccagaattcttgagcagccgcagttcaccgtggatgcggttgtgagcaccctgtcgggg
tggaaccgtgaggtcctgctggagatggcgcaacgcgcgcgcgcggcggccatcccggat
gcgactgaacgggtcgcaaacgaagtcagcctggttgcccgggcataa

DBGET integrated database retrieval system