KEGG   Citrobacter rodentium: ROD_01031
Entry
ROD_01031         CDS       T01145                                 
Symbol
secM
Name
(GenBank) secretion monitor precursor
  KO
K13301  secretion monitor
Organism
cro  Citrobacter rodentium
Pathway
cro03060  Protein export
cro03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    ROD_01031 (secM)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_01031 (secM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_01031 (secM)
Secretion system [BR:cro02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   ROD_01031 (secM)
SSDB
Motif
Pfam: SecM SecM_small PEP-utilizers
Other DBs
NCBI-ProteinID: CBG86883
UniProt: D2TGN4
LinkDB
Position
123516..124073
AA seq 185 aa
MCAKKRFEQHDWDGFNVSGILTRWRQLGRRYFWPHLLLGMVAASLGLPALSNAAEPNNAP
AKATASSHDQHIRVNFSQLALLEASNRRPNFTVDYWHQHAIRTVIRHLSFAMAPQALPVA
EETSPLQAHHLALLNTLSAMLTQEGSPAAMTPRVSYSHFAPLAAFTVPVWISQAQGIRAG
PQRLS
NT seq 558 nt   +upstreamnt  +downstreamnt
ttgtgcgcaaaaaaacgttttgaacaacatgactgggatggtttcaacgtgagtggaata
ctgacgcgctggcgacagttaggcagacgctacttctggccgcatctcttattagggatg
gtcgcggcgagtcttggcctgcctgcgctcagtaacgccgccgaacccaataatgcgccc
gcaaaggcgacggccagcagtcacgatcagcacatccgggttaatttcagccagctggcg
ctgctcgaagcgtccaaccgccggcccaattttaccgtcgattactggcatcagcacgcc
atccgcacggttatacgccatctctctttcgcgatggcgccgcaggcgctgccggtagcg
gaagaaacgtcgccgcttcaggcgcatcatttagccttactgaatacgctcagcgcgatg
ctgacgcaggaaggttctcccgcggcaatgactccgcgcgtcagctattcacatttcgcc
ccgctggctgcgtttaccgttcccgtctggataagccaggcgcagggtatccgcgccggt
cctcaacgcctcagctaa

DBGET integrated database retrieval system