KEGG   Citrobacter rodentium: ROD_03721
Entry
ROD_03721         CDS       T01145                                 
Symbol
mchD
Name
(GenBank) putative microcin secretion protein
  KO
K12340  outer membrane protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02020  Two-component system
cro03070  Bacterial secretion system
Module
cro_M00696  Multidrug resistance, efflux pump AcrEF-TolC
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_03721 (mchD)
  09132 Signal transduction
   02020 Two-component system
    ROD_03721 (mchD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_03721 (mchD)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_03721 (mchD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_03721 (mchD)
   02044 Secretion system [BR:cro02044]
    ROD_03721 (mchD)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_03721 (mchD)
Transporters [BR:cro02000]
 Other transporters
  Pores ion channels [TC:1]
   ROD_03721 (mchD)
Secretion system [BR:cro02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   ROD_03721 (mchD)
  RTX toxin transporter
   ROD_03721 (mchD)
  Multiple protein transporter
   ROD_03721 (mchD)
  RaxAB-RaxC type I secretion system protein
   ROD_03721 (mchD)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    ROD_03721 (mchD)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    ROD_03721 (mchD)
SSDB
Motif
Pfam: OEP DUF4461
Other DBs
NCBI-ProteinID: CBG87154
UniProt: D2TK24
LinkDB
Position
complement(407818..409143)
AA seq 441 aa
MQFRELHNALLALLLFFISHDAASLTLQQAILAADSYDTGIRAARELNEAEQQKRLQGFS
GLLPQINLTGGYSKQDQPKAAYAAGVTRHNYSINLSQPIFDIEKYATWRRAEAMADQGQI
NYMLMQQQLITDVSEAWFSVAYASQALKNAERTRNAFQQQLRQARRGLELGEQTRLEVDE
ALANYDNAAVEIIIAENDLNNARIRFTKITGLPGDTVPLNNMECFVSPQLPDLKKVKIHS
NQNNLNVQLARFTLDQSKADVIASTSNHLPVVTLQAAYGNNWSRGENENDFDFLFGTTSK
TRNTNIGINVSIPIFAGGGHIAQSIEAAHRKEQSRELLLDAQRKALEEAERAWYAIIAND
AKIRALQKSIASAKKRLESTTYGKQIGQRTVLDMLNAESDYYKSLKELAKARYDYITANI
QLAKATGELDYAYLTKFSCST
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgcaattcagagaattacacaacgctttgctggcgctattactcttttttatcagccat
gacgcagcatccctgacgctccaacaggccatactggccgccgatagttacgatactggt
atacgcgcggcgcgtgaacttaacgaagcggagcaacaaaagcgactgcagggcttctcg
ggcttattaccacagataaatcttactggggggtattctaaacaggatcagccaaaagct
gcctatgccgcgggggtaacccgccataactacagcatcaatttaagccagccgattttt
gatatcgaaaaatatgccacctggagacgtgcagaggcgatggccgatcaggggcagatt
aattatatgttgatgcaacagcagcttattaccgacgtgagcgaagcctggttttcagta
gcttatgcctctcaggcgctaaaaaatgcggaacgtacccggaacgcgttccagcagcag
ttacggcaggcacgacgggggctggagcttggagaacaaacgcgacttgaggttgatgaa
gccctggctaactacgataacgccgcggtagagattattattgccgaaaacgatctcaat
aacgccaggatccgctttacaaaaatcacggggctgccgggggataccgtgccgcttaat
aacatggagtgcttcgtatcgccgcagcttcccgaccttaaaaaagtgaagatccacagc
aatcaaaataatctcaacgtacagctagcccggttcactcttgatcaaagcaaggccgac
gttatcgccagcacgagtaaccacctaccggttgtcaccctgcaggctgcctatggtaac
aactggagtcggggagaaaatgaaaacgacttcgattttctgtttggtacaacgtccaag
acgcgaaacaccaatatcggaattaacgtctccataccgatatttgcgggcggaggccat
attgcgcagagtatcgaagcggcccaccgtaaagaacaatcccgcgagctgctgctggat
gctcagcgtaaagcgctggaggaagcggaacgtgcctggtacgccattatcgctaatgac
gccaaaatacgtgccttgcaaaaatcgattgcttctgcaaagaaacggctcgaatcaacc
acgtatggaaaacaaatagggcaaagaaccgttctggatatgctgaacgctgaaagcgat
tactacaagtcattaaaagaactcgctaaagcgcgatatgactatataacagcaaatatt
cagctcgccaaagctaccggtgagctcgactatgcctatctcactaaattcagttgctca
acataa

KEGG   Citrobacter rodentium: ROD_35821
Entry
ROD_35821         CDS       T01145                                 
Symbol
tolC
Name
(GenBank) outer membrane protein TolC
  KO
K12340  outer membrane protein
Organism
cro  Citrobacter rodentium
Pathway
cro01501  beta-Lactam resistance
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02020  Two-component system
cro03070  Bacterial secretion system
Module
cro_M00696  Multidrug resistance, efflux pump AcrEF-TolC
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_35821 (tolC)
  09132 Signal transduction
   02020 Two-component system
    ROD_35821 (tolC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ROD_35821 (tolC)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_35821 (tolC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_35821 (tolC)
   02044 Secretion system [BR:cro02044]
    ROD_35821 (tolC)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_35821 (tolC)
Transporters [BR:cro02000]
 Other transporters
  Pores ion channels [TC:1]
   ROD_35821 (tolC)
Secretion system [BR:cro02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   ROD_35821 (tolC)
  RTX toxin transporter
   ROD_35821 (tolC)
  Multiple protein transporter
   ROD_35821 (tolC)
  RaxAB-RaxC type I secretion system protein
   ROD_35821 (tolC)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    ROD_35821 (tolC)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    ROD_35821 (tolC)
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: CBG90292
UniProt: D2TRN2
LinkDB
Position
3772819..3774300
AA seq 493 aa
MKKLLPILIGLSLSGFSTLSQAENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPL
LPQLGLGADYTYSNGFRDANGVNSNATSASLQLTQTLFDMSKWRALTLQEKSAGIQDVTY
QTDQQTLILNTASAYFRVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNAR
SQYDTVLANEVTARNDLDNAVEELRQVTGNYYPELASLNVDSFKTDKPQPVNALLKEAEN
RNLTLLQARLTQDLAREQIRQAQDGHLPTLDLTASTGVSDTSYSGSKTRGAAGSQYDDSN
MGQNKIGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASI
SSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQQLANARYNYLLNQL
NIKSALGTLNEQDLLALNNTLGKPIPTNPDSVAPETPQQDSAVDNFNGNAAAVQPASART
TTSSGNSGNPFRN
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaagaaattgctccccatccttatcggcctgagcctgtcggggttcagcacactgagc
caggcagagaacctgatgcaagtttatcagcaagcacgcctgagcaacccggaactacgt
aaatccgctgccgatcgcgatgctgcattcgaaaaaattaacgaagcgcgtagtccttta
ctgcctcagttgggtttaggtgccgattacacctacagcaacggctttcgtgacgctaac
ggcgtaaactctaacgccaccagcgcctctctgcaattgacccagacgcttttcgacatg
tcgaaatggcgcgcgctgaccctgcaggaaaaatcagccggcattcaggatgtcacttac
cagacagaccagcaaacgctgatcttaaacaccgccagcgcctatttcagagtcttgaac
gccattgacgttctctcttacacccaggcgcagaaagaggcgatttaccgtcagttggat
caaaccacgcaacgtttcaacgtgggtctggtggcaatcaccgacgtgcagaacgcccgc
tcacagtatgacaccgtcctggcgaacgaagtgaccgcgcgtaacgatctcgacaatgcg
gtggaagaactgcgtcaggtcaccggcaactattatccggaactggcgtcgctgaacgtc
gacagttttaaaaccgacaagccgcagccggtgaacgcgctgctgaaagaagcggaaaac
cgtaacttaacgctgttgcaggcccgtctgacgcaggatctggcacgcgagcagattcgc
caggcgcaggacggccatctgccgacgctggatttaaccgcctctaccggcgtctctgac
acctcctacagcggttcaaaaacccgcggcgctgccggttcacaatatgacgacagcaac
atgggccagaacaaaatcggtctgagcttctcgctgccgatttatcagggcggaatggtc
aactcgcaggtcaaacaggcgcagtacaactttgtcggcgcgagcgagcagctggaaagc
gcccaccgcagcgtcgtgcagaccgtgcgttcctctttcaataatatcaacgcctccatc
agcagcattaacgcctacaaacaggcggtagtctctgcccagagctctctggacgcgatg
gaagccggttactccgttggtacgcgtacgatcgtcgacgtgctggatgcgaccaccacg
ctgtacaacgccaagcagcagctggccaatgcgcgctataactacctgcttaaccagctg
aatatcaaatcagcgctgggtacgctgaacgagcaggatctgctggcgctgaacaatacg
ctgggcaaaccgattccgaccaacccggacagcgtggcgccggaaacgccgcagcaggac
tccgccgttgataactttaacggcaatgctgctgccgtacagcctgcaagcgcgcggacg
acaacctcctctggcaacagcggtaatccgttccgcaactaa

DBGET integrated database retrieval system