KEGG   Citrobacter rodentium: ROD_04081
Entry
ROD_04081         CDS       T01145                                 
Symbol
uhpB
Name
(GenBank) two-component system sensor histidine kinase
  KO
K20263  two-component system, NarL family, sensor histidine kinase FusK [EC:2.7.13.3]
Organism
cro  Citrobacter rodentium
Pathway
cro02020  Two-component system
cro02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_04081 (uhpB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROD_04081 (uhpB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cro01001]
    ROD_04081 (uhpB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_04081 (uhpB)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ROD_04081 (uhpB)
Protein kinases [BR:cro01001]
 Histidine kinases
  NarL family
   ROD_04081 (uhpB)
Two-component system [BR:cro02022]
 NarL family
  FusK-FusR (virulence regulation)
   ROD_04081 (uhpB)
SSDB
Motif
Pfam: MASE1 HisKA_3 HATPase_c HATPase_c_2 Ufd2P_core HATPase_c_3 DUF6016
Other DBs
NCBI-ProteinID: CBG87190
UniProt: D2TKU9
LinkDB
Position
complement(458754..460301)
AA seq 515 aa
MSHPLRYVVISLFIVLAWGTGWLMLWTLGFYLTHNGQQAALFLPHGVYLALLILLARRYW
PALVLPPMLMLLWLRSEQLLSGDLLVLLAAPLVSLLPASIAQRFWQRFPLYWQRLTLLLT
AVTVASLLNTALLSPLLKSPAMLSGLASFTGGVLLTPFVYLIFEFLRQQHRYQLLAQDTQ
NPPLRTSLIIWCSLFFIIGIGTQLTLSPELERLLLIVVFLPNVVMAWKFGWQGGVLAGLL
GSMMITIARQVGVGFSNLIELEIFLATQALLGMGLGIAISRQQHLAQNLHHYRQRLEAEL
AARRALTEKLIHSEEDTRKSLARELHDEIGQNITAIQIQTQLVKRARDPAQTQAAASQIN
DLARRIHHSTRQLLRQLRPPALDELSFNEALHHLLNEFAFAERGIRCRFDYRLTATPESE
TVRFTLYRLLQELLNNVCKHAEASEVAILLCQQGERLRLEVQDNGTGIGDGQLPGFGIQG
MRERVSALGGELSLESRHGTRVIVNLPTNLQQTHG
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtcgcatccgcttcgttatgtcgtgatctcgctgtttatcgtactggcctggggaacc
ggctggctgatgctgtggacgctcggcttttatctgacccataacggccagcaggcggcg
ctgttcctgccgcacggcgtctatctggcgctgctgatcctgcttgcgcgccgctactgg
ccggcgctggtgctgccgccaatgctgatgctgctctggctgcgcagcgaacagctgctg
agcggcgatctcctcgtcctgctggctgcgccgctggtcagcctgcttcccgccagcata
gcgcaacgcttctggcagcgctttcctctgtactggcagcggctgacgctgctgctgaca
gcggtcaccgtcgcgtcactgctcaataccgccctgctttcaccgctgctgaaaagcccg
gcgatgctgtccggcctggcctcattcaccggcggcgtactgctgacgccgttcgtctat
ctgattttcgaatttctgcgccagcagcaccgttatcagctgctggcgcaggatacccaa
aacccgccgctgcgcacctcgctcatcatctggtgcagcctgttttttatcatcggtatc
ggcacccagctgacgctgtcgccggagcttgaacgcctgttactgatcgtggtttttctg
cccaacgtggtaatggcgtggaaattcggctggcagggcggcgtgctcgcaggcctgctc
ggcagcatgatgatcaccatcgcccgccaggtcggcgtcgggttcagtaatctgatcgaa
ctggaaattttcctcgccacccaggcgctgctgggcatgggtctgggaattgccatcagc
cgccagcagcacctggcgcaaaacctgcaccactatcgccaacggctggaagcggaactg
gcggcgcggcgggcgctgaccgaaaagctgatccacagcgaagaggatacgcgaaagagt
ctggcgcgcgagctgcacgatgaaatcggccagaatattaccgccattcagatccagacg
cagctggtgaagcgggcgcgcgatccggcgcaaacccaggccgccgccagtcaaatcaac
gatcttgcccgccgcatccaccactccacccgccagctgctgcgtcagcttcgtccgcct
gcgctggacgaactgtcgtttaacgaagcgctgcatcacttgctcaatgaatttgccttt
gctgagcgcggcatccgctgccggtttgactatcggctgaccgccacgccggaaagcgaa
acggtgcgctttacgctctatcgcctgcttcaggagttactcaataacgtctgtaaacac
gccgaagccagcgaggtcgccattctcctgtgccagcagggagaacggctgcgcctggaa
gtgcaggataacggcacaggcatcggcgatggacaacttcccggcttcggcattcaggga
atgcgcgagcgcgtcagcgcgcttggcggcgaactgtcgctggagtcgcggcacggcacg
cgggtaattgttaacttgcccacaaatttgcaacaaacccacggctaa

DBGET integrated database retrieval system